SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2JR85 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2JR85
Domain Number 1 Region: 9-67
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000045
Family Phage repressors 0.036
Further Details:      
 
Weak hits

Sequence:  H2JR85
Domain Number - Region: 296-371
Classification Level Classification E-value
Superfamily TPR-like 0.0247
Family Tetratricopeptide repeat (TPR) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2JR85
Sequence length 408
Comment (tr|H2JR85|H2JR85_STRHJ) Uncharacterized protein {ECO:0000313|EMBL:AEY87293.1} KW=Complete proteome; Reference proteome OX=1133850 OS=Streptomyces hygroscopicus subsp. jinggangensis (strain 5008). GN=SHJG_2018 OC=Streptomyces.
Sequence
MARPAGNFRLKAARVAAGYYSQQALAEALGVGVRQVRRWESEQPPVPQPEVAQALTRLLG
QDLEALGFTPTGGRPAGHARRTVLAATAAAVGLAAVPTQAIAMQPATAAEDFEAVTRSHR
RLYWTVAPATLHPAAIAHATLGCALLPEAAGQTRQRIAAALAETWLLAGRIEFFDLRDPD
QAAHTLLRALQAAGEADDPLLGAGALAHTAFIPGWDGRREEAVERMVAARTYARRGPASA
ELLAWLDAVEAECETRCGNPRTALHLIGHAEDVLAQGSDHVSPEWLDWFSPVRLAAFKGN
TQLRAGHLPQARATLLQVLDELGPQDEKQATVILGDLAAVEAAAGNPEAACGYAVRALDQ
LERTWYAMGMDRVREVRRALAPHQHEQCVRDLDDRLYGWSTTVSALAR
Download sequence
Identical sequences H2JR85
gi|474980317|ref|YP_007690783.1| gi|386838108|ref|YP_006243166.1| WP_014670633.1.21199 WP_014670633.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]