SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2JRN7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2JRN7
Domain Number 1 Region: 3-281
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.85e-75
Family Protein kinases, catalytic subunit 0.00000644
Further Details:      
 
Domain Number 2 Region: 357-473
Classification Level Classification E-value
Superfamily TPR-like 0.00000000641
Family Tetratricopeptide repeat (TPR) 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2JRN7
Sequence length 504
Comment (tr|H2JRN7|H2JRN7_STRHJ) Serine/threonine protein kinase {ECO:0000313|EMBL:AEY89844.1} KW=Complete proteome; Reference proteome OX=1133850 OS=Streptomyces hygroscopicus subsp. jinggangensis (strain 5008). GN=SHJG_4573 OC=Streptomyces.
Sequence
MVAGRYELSTLIGQGGMGQVWTAYDRRLDRRVAVKLLRPDKVAGQEADELRRRFVRECRV
TAQVDHPGLVTVHDAGSEGEELFLVMQYVDGADLSDHLAEHDPYPWQWTVAVAAQLCAVL
SAVHAVPIVHRDLKPRNVMVKQDGTVTVLDLGVASVMDTDTTRLTHTGSPIGSPAYMAPE
QAMGGAVGPYTDLYALGVLMHELLSGEVPFAGSTALGVLHRHLYEPPLPVRRIRPEVPEA
LEALVLRLLAKDPQHRPASAQEVYEDLALLLPARGTPTGAPLDPTRPFLRPHAPWPDRAR
TPAHQPAPVAPAPPVAEKPDVAAAVDEVKRLLGEGRITQAVDILGAILPAAAEQHGELSP
VVRTLRKQYAATLMDDGQYRRALPELRRLADERAAEAGQADPQSLRYRYEAAQCLEQLGE
PAAALAEYRALLPYYENQYVSGDPQLAHEVRRRIGHLLLALGDRPAAHDTLARLVLDVER
LHGPGHPLAVEIRRTLQWLGQVRG
Download sequence
Identical sequences H2JRN7
gi|474982868|ref|YP_007693334.1| gi|386840659|ref|YP_006245717.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]