SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2JSC3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2JSC3
Domain Number 1 Region: 294-568
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.06e-28
Family RecA protein-like (ATPase-domain) 0.049
Further Details:      
 
Domain Number 2 Region: 115-287
Classification Level Classification E-value
Superfamily TPR-like 6.32e-27
Family BTAD-like 0.0011
Further Details:      
 
Domain Number 3 Region: 20-93
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.0000000000879
Family PhoB-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2JSC3
Sequence length 669
Comment (tr|H2JSC3|H2JSC3_STRHJ) Regulatory protein {ECO:0000313|EMBL:AEY86074.1} KW=Complete proteome; Reference proteome OX=1133850 OS=Streptomyces hygroscopicus subsp. jinggangensis (strain 5008). GN=SHJG_0797 OC=Streptomyces.
Sequence
MPVTPRRRIGEEQGPAQAVRFTLLGPVRAWRAGEELPLGPRQQRLLLAALLAGAGRPVPL
TELIGLLWDGDPPVSAVNAVHRYVGSLRRLLEPGLPIRSSGRWLVRQAGSYLLRVDADGL
DLLRFRDLVRRARAATATGDLPAAVDRYLEALDLWQGHCAEDLGAVASVHPAFAMVEHEY
APVVCEAATAALRCGRAGSVLLTVRQAADRCPLDEALQASLLLVLAADGKQAEAIMLYQT
IRARLSDELGVDPGAELRAAHQSVLRGSPAEPRVPASTGSAAPPAAPLPRSRPPWIEPAQ
LPPDLPFFTGRERALDQALDTAHRVGAGLRVLAVDGIPGVGKTALAVHFAHRVAGDFPDG
QLYTDLGGFAAHGDPADPGEVLHGFLEALGVDRHRIPASLEARSALYRSVLSGRRVLVVL
DNALDAEQVRPLLPGTSECMVVVTGRSRLIGLAAAHGARLLSLDLPSVAEATACFLRRVG
PARTDVGVAVVEEIVARCGRLPLALALVAARAASRPEQPLTRLAAELAAAQGSLGGFDEE
DSANAVRGVFSWSYRTLGAEAKRVFRLLPRHRACDIGTAGLASAAGISRDAAATAVGELV
RARLLDIRGRDRYGAHDLVLAYAAELDRAGEADRSAAPRRSYVHSRRSARPVARPVPGRA
DAHLEEWAF
Download sequence
Identical sequences H2JSC3
gi|474979164|ref|YP_007689630.1| gi|386836889|ref|YP_006241947.1| WP_014669422.1.21199 WP_014669422.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]