SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2JTJ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2JTJ3
Domain Number 1 Region: 302-569
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.84e-26
Family Extended AAA-ATPase domain 0.032
Further Details:      
 
Domain Number 2 Region: 109-271
Classification Level Classification E-value
Superfamily TPR-like 6.32e-25
Family BTAD-like 0.0012
Further Details:      
 
Domain Number 3 Region: 736-941
Classification Level Classification E-value
Superfamily TPR-like 5.22e-20
Family CT2138-like 0.062
Further Details:      
 
Domain Number 4 Region: 14-107
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.000000000000207
Family PhoB-like 0.0014
Further Details:      
 
Weak hits

Sequence:  H2JTJ3
Domain Number - Region: 560-609
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0091
Family ArsR-like transcriptional regulators 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2JTJ3
Sequence length 974
Comment (tr|H2JTJ3|H2JTJ3_STRHJ) Regulator {ECO:0000313|EMBL:AEY86094.1} KW=Complete proteome; Reference proteome OX=1133850 OS=Streptomyces hygroscopicus subsp. jinggangensis (strain 5008). GN=SHJG_0817 OC=Streptomyces.
Sequence
MTGLSRESADHAIQFSVLGPVRVWRGGGELLLGPKQQRLILAVLLARAGRPVSMHEFIDL
LWDGDPPSSATNAVHRYVGALRRLLEPDLPARSPGRWLARQAGGYLLRVDADCLDLLNFR
ALVDQARQADAAGDPTGSVGLFTTALDLWQGRCAADLEPVSSTRPAFVMLEHEYVSVVCE
AADTALRCRRAEAVLLPLRRAAERNPLDEALLARLLLVLASDGKQAEALAMYEEIRLRLA
EELSVDPGAELRAAHERILRHRFDAGAPAEAEEDEGAAYGPPVPAGSMPSPAPSPRTARP
AQLPPGLPGFTGREDALAQARALAARGGGALRVLAVDGIPGIGKTALAVHFAHQVASDFP
DGQLYADLRGFAPDGKPADPADILQGFLDALGVAPQRIPTSPDTRSALYRSVLADRRVLV
VLDNARDLAQIRPLLPGTGNCMVIVTSRSRLTALAAAHGAHLLTLDVPSPAEATNAFLER
VRASRPDATAREVRPLVERCGRLPLAVAIVAARAAAYPERTLHDIDLELSTTDHSLDGFS
DDNLDNDVRGVFSWSYRTLGPQAAHLFRLLPLHPGPDVTAAALASMAGISPHEAVQAMGE
LVRARLLTVRARNRYRAHDLILAYAAELAAQYERDRPAVRSRMYDHYRQTAHAANLLLRP
GPQPASPAAPLPSVTPEPLADTATATAWYTRERAVLRSVVEAAAAHGDSRMAWELAVTLQ
MCQQRMGWWHDWAATMRAALAAARKAEDAEGMARTHHGLAGALHSLGDLPGALRHLEQAR
RRFEQLRSTTDLAHVLGNIGVVYSSQEDHVRALRHMEAALDLLCGPEPRHLRAATLSDTA
MTRVKLGDPEGALRLARTAVVMFRDLRDLNGEGLTLTIIGQVFRRRRDYARSASYYERGI
ELMRLAGNRGNVAEELMALGDVRLDARDVAGARRAWTDALRSLDDPELPLAARAREKLAL
LDTVEEQREAASVI
Download sequence
Identical sequences H2JTJ3
gi|474979184|ref|YP_007689650.1| gi|386836909|ref|YP_006241967.1| WP_014669442.1.21199 WP_014669442.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]