SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2JTV7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2JTV7
Domain Number 1 Region: 63-262
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.22e-32
Family Protein kinases, catalytic subunit 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2JTV7
Sequence length 526
Comment (tr|H2JTV7|H2JTV7_STRHJ) Putative serine/threonine protein kinase {ECO:0000313|EMBL:AEY87422.1} KW=Complete proteome; Reference proteome OX=1133850 OS=Streptomyces hygroscopicus subsp. jinggangensis (strain 5008). GN=SHJG_2147 OC=Streptomyces.
Sequence
MTMVKAHVSAREPVDGRYRLLEVFARETNRLWWYAEDVAAERPRLVARTALPEPVGQDTA
RRVTARVVRTSETMRLLRPGQVAAVVDAVVEAGALWTVTEWVDGTPLGELLAQEGSLHPV
RAARLGLELLDVLQAAHDEGVTHGELSPGQVFVRDGGPVVVTGFGLAGATLVPRLTAPSY
ASPEQARDERIGPAADLWALGALLYTMVEGRPPFRDRGRPDATLRAVDRLPLRTPLRAGP
LTQVVQGLLRKDPRERPTRPVVREALTRALREDADAERRPAPESWLRGAYRAVRHAGPPR
GGRALAAGTALAVVTVAAAALAASGALSSGTDTAGAPPRATPSGPAARQPGGGAKPTPTP
TSAPSSKPAPALPAGYRRYSAPEGFSVALPDGWKRLTTSRVSGLAYRVTFGRDGGPSTLA
VTYSERVGPDPVAVWRDDVEPGLRKLPGYDRVGAVRATTYQGRRAADLEWLAGSGTARTR
TFGRGFLLGGTRGFSLRFTTPAAAWDDAANWLARRTFLGTFRTPQE
Download sequence
Identical sequences H2JTV7
WP_014670762.1.21199 WP_014670762.1.57224 gi|474980446|ref|YP_007690912.1| gi|386838237|ref|YP_006243295.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]