SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2JUZ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2JUZ2
Domain Number 1 Region: 855-1142
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.59e-65
Family WD40-repeat 0.0000688
Further Details:      
 
Domain Number 2 Region: 460-749
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.86e-64
Family WD40-repeat 0.0000946
Further Details:      
 
Domain Number 3 Region: 22-311
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.61e-55
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 4 Region: 331-433
Classification Level Classification E-value
Superfamily TPR-like 0.0000000127
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2JUZ2
Sequence length 1266
Comment (tr|H2JUZ2|H2JUZ2_STRHJ) Protein kinase {ECO:0000313|EMBL:AEY86191.1} KW=Complete proteome; Reference proteome OX=1133850 OS=Streptomyces hygroscopicus subsp. jinggangensis (strain 5008). GN=SHJG_0914 OC=Streptomyces.
Sequence
MRQGAAAAVGEWRDWRVGDRVLGVYEVTGALGQGGMGRVHRVRHLGWGTDLAVKSPRPEL
FRDEADQERFVREAETWVGLELHPHLCGCHYVRTIGGVPRVFAEYVDGGSLRESIDDGRL
YRGARDEVVGRILDIAVQMARGLAHAHLSGVVHQDVKPGNVLLDRRGTAKITDFGLARAR
HFGTRPTPSDRVADGAAPGGAALDAATLLVTHGGMTPAYASPEQVRGAPLSRRTDVWSFA
VSVLEMFTGAVTWGVGSAAGAALAAYRLSPPPDAPVASMPGALADLLERCLRERVEERPD
DLAAVAGELAEVYAREVARPYPRRAENAAVHRADGLNNRAMSLLDLGRTREAEAALAEAH
AADPQHPQATYNLGLLRWRSGTLADDALVDRMESARASAEGPSPADHLLAHVHLERGDHE
SALPLLRAASATAEATADADAGTAPRDALAHAEREHAAGGRLLATFTGHRAVVHAVSLSA
DGSRALSGDDAGDVRLWDTATGRPRALKGHRAAVHAVSLSPDGRLALTGGHDGDVRLWDT
GTGRCLRRLSGHTGSVRAARLAPDGSTALTGGWDGTLRWWDVATGRCLRVVDSPEGPGGA
GREVNAACLSADGRLALFVGGRTVLWDLVEDRRVRTLDRGTIWPAALSHDRRYALTGGGD
RALEWWDLATGRPLRTLRADARPPWTAELSADGRFAVTGAIGGTLRWWELATGRCLRTYD
AHFSQVTSVSLSGDGRRVLTGGDHRVRLWQLPAPDAYTAPFRICRPRSHTELTRYDDRVA
ALLDDAESAAGRQRYADALALVTEARALPGHERDTRALAAWHRLSLVTVRTGVRGAWPAG
TVELSTNGTQAHATADGRRALCADLGTLRLWDFEDGGRCVRTFDGHEGAVEAVSLSADER
LALSGGEDGTVRLWDVRTGRCLSVLTGHGAKVRSVSFSGDGRFAFSGGEDGSVRWWELAT
GRMLRAYEYGGQGVYSVCPSADGRFLLSCGEGGRARLWELDSGHRVRTFEDLDRDAVTDS
PLLGILHSARLTADGRHAVTANGDGRVALWDVAAGRCLHVFEEHVGSDGHAEPMTSVSLS
TDGRFALAANWDTTVRLLDLRAGRCLRTLGGHRRWVLSVHLSADGRYAVSTGTDRTLRRW
ELDWELEAREPADWDEGARPHLEAFLAAHTPFGRPVPHGLQSVSYDPRLARHGRPVWSEA
DADLLLRHLARAGYGWLRAAGVRAELERMAAAWQGPRPLPAPRPGPTGLLSSARHRYRAW
RGRPRS
Download sequence
Identical sequences H2JUZ2
gi|474979281|ref|YP_007689747.1| gi|386837006|ref|YP_006242064.1| WP_014669537.1.21199 WP_014669537.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]