SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2JW98 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H2JW98
Domain Number - Region: 3-117,191-309
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000157
Family Quinoprotein alcohol dehydrogenase-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2JW98
Sequence length 382
Comment (tr|H2JW98|H2JW98_STRHJ) Uncharacterized protein {ECO:0000313|EMBL:AEY93210.1} KW=Complete proteome; Reference proteome OX=1133850 OS=Streptomyces hygroscopicus subsp. jinggangensis (strain 5008). GN=SHJG_7944 OC=Streptomyces.
Sequence
MQAYDLATGKVAWTFTPAALSDARTGVFVVTVGGREQVLLARQGKTSGDGLKQSAPTVTV
DIIPADSPAKATAAHHLDLPVPSDRALSFAASGSGFLVGAADHGTYSQATVIDPATGAKR
SVTAKDVTVPGCGGATCTLRATPAFATSAGVVSTYQQTTGCDRWGNGSGQPCTTGFQVGD
AWTSTTTAPRGMHTGIPLAVTGKYLIAAWHTSDSQTDQPALSADSKTTFTVQDLATGKRI
ASVSCTSADQLTLQPGSAQSSTRTSANGRYLVSGQTAFDLNSRTGRCYTSSASSKGIDFT
AVGDDGTAYGLIHTGDGSDASSLYGRLPIAPDGTDSTEQGARVDLAAGSAKALSEAAEVP
IYLAASDGVFRTGDVLAVYARR
Download sequence
Identical sequences H2JW98
gi|386844025|ref|YP_006249083.1| WP_014676493.1.21199 WP_014676493.1.57224 gi|474986236|ref|YP_007696702.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]