SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2JWX0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2JWX0
Domain Number 1 Region: 62-380
Classification Level Classification E-value
Superfamily ADC synthase 4.45e-59
Family ADC synthase 0.00021
Further Details:      
 
Domain Number 2 Region: 431-616
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 3.54e-23
Family Class I glutamine amidotransferases (GAT) 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2JWX0
Sequence length 623
Comment (tr|H2JWX0|H2JWX0_STRHJ) Anthranilate/para-aminobenzoate synthase component I {ECO:0000313|EMBL:AEY88873.1} KW=Complete proteome; Reference proteome OX=1133850 OS=Streptomyces hygroscopicus subsp. jinggangensis (strain 5008). GN=SHJG_3601 OC=Streptomyces.
Sequence
MDLMDLLSDPRPFALLRRRTPGRDEHLVEVLLGPVTSRDRLADLPDEGLALIPFRQIRER
GFDVRDDGTPLLVLTPQETHTLSLAEALDRLPAHDVRVEGGGFDVSDEEYAETVGRVLRE
EIGRGEGANFVIRRTYEGGIPGFGRADALALFRRLLEGERGAYWTFVVHTGDRTLVGASP
EVHVRMSGGTVVMNPISGTYRYPPEGPTPEHLLGFLADGKEIEELSMVVDEELKMMCTVG
DRGGVVVGPRLKEMAHLAHTEYELRGKSSLDVREVLRETMFAATVTGSPVQNACRVIERY
ERPGRDGVGRGYYAGALALLGRDSGGAQTLDSPILIRTADISADGRLRVPVGATLVRGSD
PAGEVAETHAKAAGVLAALGVRPSRPRAERERPRLADDPRVRAALDGRRAALAPFWLRMQ
DRAPEPAGHALVVDGEDTFTAMLAHVLRSGGLEVTVRRYDEPGLRAAVLAHEGPVVLGPG
PGDPRDGADAKMRVLRELAATVIREHRHGVLGVCLGHELIAAELGLDLVRKEVPYQGAQT
EIDLFGRPETVGFYNSFVARCDEEAARELAAHGVEVSRAANGEVHALRGPGFAGVQFHPE
SVLTLNGAAVVRELIGQLRRTTV
Download sequence
Identical sequences H2JWX0
gi|386839688|ref|YP_006244746.1| WP_014672205.1.21199 WP_014672205.1.57224 gi|474981899|ref|YP_007692365.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]