SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2JXC9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2JXC9
Domain Number 1 Region: 25-231
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.00000000000000183
Family Prokaryotic proteases 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2JXC9
Sequence length 277
Comment (tr|H2JXC9|H2JXC9_STRHJ) Uncharacterized protein {ECO:0000313|EMBL:AEY91357.1} KW=Complete proteome; Reference proteome OX=1133850 OS=Streptomyces hygroscopicus subsp. jinggangensis (strain 5008). GN=SHJG_6090 OC=Streptomyces.
Sequence
MNKPLLAALSSLAIAGLGATPAVAAPHSAKAAAVTVDFAGTVSLSNCSGSVIRFPGSADT
DPALVLTNGHCLETGFPDPGEVITGQSSSRTFGLLNSAGTKVATLRANQVVYSTMTDTDV
TIYRTTTTYAAIKSSYGISPLTVQDTHPVAGTAIKVVSGYWKRIYGCNIDGFVYRLKEGD
WTWKDSVRYTSACDTIGGTSGSPVIDTATGKVVAVNNTGNEDGQQCTVNNPCEVDANGTV
TVRQGINYAEETYNIPACFTTGNKLNLSAAGCTLPKP
Download sequence
Identical sequences A0A101QIX0 H2JXC9
WP_014674651.1.21199 WP_014674651.1.28171 WP_014674651.1.57224 gi|386842172|ref|YP_006247230.1| gi|474984383|ref|YP_007694849.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]