SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2JYH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H2JYH2
Domain Number - Region: 381-473
Classification Level Classification E-value
Superfamily TPR-like 0.032
Family CT2138-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2JYH2
Sequence length 488
Comment (tr|H2JYH2|H2JYH2_STRHJ) Regulator {ECO:0000313|EMBL:AEY88943.1} KW=Complete proteome; Reference proteome OX=1133850 OS=Streptomyces hygroscopicus subsp. jinggangensis (strain 5008). GN=SHJG_3671 OC=Streptomyces.
Sequence
MTDRPAQRTPNRQLAALIAEAGFSNAGLARRVDQLGLEHGLDLRYDKTSVTRWLRGQQPR
GTTPALIAEVFTRRLGRRLTAQDLGLDACAPVYAGLEFAATPEEAVDIVSGLWRKDSGSH
AELRKIAFTPAGLVVPSRDWLIGKADDRVAREPVPRVPPQGRPGAARAPQPGPLVPPRLR
TPAERTPGHRVTGGDIAALHSVGELFRTLDDRFGGGHARQALVRYLEHECEPMLRGSYDE
QTGRRLFAAAADLTRLAGWTSYDIAAHGLAQRYFVQALRLAQAAGDRAYGSYVLVTMSRQ
AVYLGHGREAVQLARVAQQGVGTGAPPVVQALLHASEARAHGVLGEVRACTAALVRAERA
LEAARPGDEAPYWAAFFDEAQLADEFGHCHRDLQQFRAAAQHAERSLQLRAPAYARSRLF
CRVVLATARLGLGELDQACAIAAEAAGQAAEMRSARAVEYVQEFERRLEPYRDAAPVRVY
REKVAALG
Download sequence
Identical sequences H2JYH2
gi|474981969|ref|YP_007692435.1| gi|386839758|ref|YP_006244816.1| WP_014672275.1.21199 WP_014672275.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]