SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2JZ74 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2JZ74
Domain Number 1 Region: 1-234
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.77e-50
Family Protein kinases, catalytic subunit 0.0000646
Further Details:      
 
Domain Number 2 Region: 463-690
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 4.71e-17
Family Quinoprotein alcohol dehydrogenase-like 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2JZ74
Sequence length 712
Comment (tr|H2JZ74|H2JZ74_STRHJ) Uncharacterized protein {ECO:0000313|EMBL:AEY92084.1} KW=Complete proteome; Reference proteome OX=1133850 OS=Streptomyces hygroscopicus subsp. jinggangensis (strain 5008). GN=SHJG_6817 OC=Streptomyces.
Sequence
MGTVYLARTAGGRTVALKTMHARIASDPAFRTRFRLETDAARVVGERYGAGVVDADPRAE
TPWFASEYVLGPPLDEAVELCGPLPEISVRALGAALCGALGQLHGSDVVHRDLKPSNILI
TAYGPKVIDFGIARAAGDDRLTRIGVAVGTPAFMSPEQAAGQEHSTAGDVFALAGVLVFA
ATGRPPFGHGQAADLLYRVQYGEPDLSGVPDSLVSVLARCLDKNPFRRPTTSQLSGELHD
GSGEFADHLPGALLADIARRATEVWQITPQRLPAPPEEAETAVPAATARPLRRRLLITGG
AAALAVAGAGAGAWAWRERTGAAPTPRPTQGTGDGQLPRKKLDSVWQIQVGDPLDDTVPA
QLHVVHNLVTLVAGMGLGGIVAETGYIQFASDQMENTWQVATDGERVIRLVQADGSENNA
GKPGGFPLLLASVDLLTGKAAEPFAEFTDFNGVLTQNQLLCTADGIAYVAAGRGKFSIKG
FLASQSWSLLAVDISSGKRLWTTPLPARREGSGRLYFLSAVVAGHRLVTLQEENDGTVRA
VVRDTRTGAVRWETPLHGVAPDRARQPLAVDDDHLYVGSGPLRALRLGDGKAAWETTSKS
PDAVYGPPVVKDDVVYVAQKGYGLVGFSGDRGLVMWKEEGRQGAKADVTAPPVIGPHYIY
NKRGSELWAIAWSSTGAPVRSFKTTGDRFIAHERSGLVIALGGRFLAAFPLE
Download sequence
Identical sequences H2JZ74
gi|474985108|ref|YP_007695574.1| gi|386842899|ref|YP_006247957.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]