SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2JZK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2JZK5
Domain Number 1 Region: 103-258
Classification Level Classification E-value
Superfamily TPR-like 9.86e-30
Family BTAD-like 0.00049
Further Details:      
 
Domain Number 2 Region: 5-98
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.000000000153
Family PhoB-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2JZK5
Sequence length 648
Comment (tr|H2JZK5|H2JZK5_STRHJ) SARP family transcriptional regulator {ECO:0000313|EMBL:AEY86439.1} KW=Complete proteome; Reference proteome OX=1133850 OS=Streptomyces hygroscopicus subsp. jinggangensis (strain 5008). GN=SHJG_1162 OC=Streptomyces.
Sequence
MEGMRIDVLGAVRALRDDGAPVDLGGPRHREVLARLVAAEGRMVATDTLVDDLWAEPPVR
AVGALRTFVAALRRAIEPDRPPRTPPRVLVTEGPGYVLRLPRDNVDVHRFEDALARARRT
PDALTGLDAALAAWRGPAYADVTGSAWAERERTRLEELRLEGVELRARILLDSGAGAELV
AELGAHVTEHPWREPAWGLLARALHRAGRQADALATLRRARTMLADQLGLDPGADLRRLE
TDILHGATTLQPARTVWTAGVRLGPRTTVELARTLALAGGDALVHSRRDRLAAAQAAERT
GDIALTARVIGAYDVPALWSRADDPEQSRAVVAAAERTLTALGPDSPAELRARLLATVAV
ESRSADLSGSERRRAGQAAREAEALAREWGDPALLVFALNGVFLQSFTRPGLAAARDAIG
AEILDLATRHELTNFAVLGRLIRLQSASALGDLHAATAHAEAAEQLAVSTEASLVPVLTG
WFRARATAARSAEPGGPTAATAAAHYRAAETALADTAGMPGLHRGLFALALLGLRLLHGR
PAPTDPALDWGPYHPWTRPLVLLARNRVEEARTALAGAPEPPLDHMQEALWCLTAHAAAR
LGERPVAARAAAALRPARTEHAGGASGLLTLGPVARYLAEAEACARKR
Download sequence
Identical sequences H2JZK5
gi|386837254|ref|YP_006242312.1| gi|474979531|ref|YP_007689997.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]