SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2JZP7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2JZP7
Domain Number 1 Region: 73-232
Classification Level Classification E-value
Superfamily TPR-like 1.64e-33
Family BTAD-like 0.00069
Further Details:      
 
Domain Number 2 Region: 1-50
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.00000000187
Family PhoB-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2JZP7
Sequence length 246
Comment (tr|H2JZP7|H2JZP7_STRHJ) SARP family pathway-specific regulator {ECO:0000313|EMBL:AEY86481.1} KW=Complete proteome; Reference proteome OX=1133850 OS=Streptomyces hygroscopicus subsp. jinggangensis (strain 5008). GN=SHJG_1204 OC=Streptomyces.
Sequence
MLALLIANSNRYVSQSAITKELWGTTPPRSAANTVQTYVMQIRKLLDSALAQSEGMRATD
VLVTGVGGYQLSVAPGDIDLTRYLDLAADGESALLDKDYVRAAHKLADALAMWRDDALCN
VRRGPMLDTFVREMDDSRTITLERRIEAELCLGQHYGVLRELTELTRTHPLNENLHSQFM
LALYRAGRRVQALKVYQRLRKRMTEELGLDPSPRLQQLQTAVLNCDRSLEFENRPGLFSS
RILPAC
Download sequence
Identical sequences H2JZP7
WP_014669827.1.21199 WP_014669827.1.57224 gi|474979573|ref|YP_007690039.1| gi|386837296|ref|YP_006242354.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]