SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2JZQ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2JZQ9
Domain Number 1 Region: 43-551
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.57e-148
Family Quinoprotein alcohol dehydrogenase-like 0.0000000297
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2JZQ9
Sequence length 569
Comment (tr|H2JZQ9|H2JZQ9_STRHJ) Alcohol dehydrogenase {ECO:0000313|EMBL:AEY87707.1} KW=Complete proteome; Reference proteome OX=1133850 OS=Streptomyces hygroscopicus subsp. jinggangensis (strain 5008). GN=SHJG_2432 OC=Streptomyces.
Sequence
MTVDYADYVDAGEAVDQGTLNYKTPGGDVAPPVVAGVDYERILNARQEPHNWLTYYGAYN
GQRYSPLDQINTENVKRMVPAWVFQAGTTGLIAGASTYSFEAAPIVVDGVMFLSGWDGWV
WALDAKTGVEIWRYKHAVPFDVSLCCGNVNRGVAVAQGKVFFVTANARVLALDATTGRRV
WDKTYGDVRAGESATLAPLVVKNMVIVGSSGGEFGVRGHLDAFDLETGEHQWRCYTVPKP
GEPGSETWPADGEAWARGGANCWITGTFDPETNLLYVGTGNPAPDFDGEVREGDNLFTDS
IIAVDVDSGQIRWHYQCTPHDVWDYDSIGECILFEKDGRKLLGHFDKNGYFFVLDRTNGA
RVGITPFVDRITWGAITRDGQVTAKVYPDKEGEPVHFYPGPAGAKEWTHASYSPKTELFY
VPVQDTGATATRRRREFKESIPYWGAGVQVDIEDMAGSVSAFDADGEEKWRWRNELPMCA
STLVTGGDLVFAGEASGEFNALDARTGELLWQFQCGSGHHSSPTTYMVDGRQYVAVPVGW
GGWAEGFLPGMLGAGHGSALIVFALPEPS
Download sequence
Identical sequences A0A0S2NV54 A0A101Q3T1 H2JZQ9
WP_014671047.1.21199 WP_014671047.1.28171 WP_014671047.1.57224 WP_014671047.1.88765 gi|386838522|ref|YP_006243580.1| gi|474980731|ref|YP_007691197.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]