SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2K564 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H2K564
Domain Number - Region: 26-128
Classification Level Classification E-value
Superfamily TPR-like 0.00223
Family Tetratricopeptide repeat (TPR) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2K564
Sequence length 170
Comment (tr|H2K564|H2K564_STRHJ) Uncharacterized protein {ECO:0000313|EMBL:AEY88029.1} KW=Complete proteome; Reference proteome OX=1133850 OS=Streptomyces hygroscopicus subsp. jinggangensis (strain 5008). GN=SHJG_2755 OC=Streptomyces.
Sequence
MAERQEQAAPDAVLTRIGQVVMLHHGGDREEARSRFLDLWAEVGEEGDPLHRCTLAHYLA
DTQDDPADELAWDLRALSAAEEAADGRVGADPSNVRGFFPSLHLNLAADYAKLGRAEAAR
SHLRRARSAARCLADDGYGAGVRSEISRLALRLGEDGTPGEEGWRPPRQG
Download sequence
Identical sequences H2K564
WP_014671369.1.21199 WP_014671369.1.57224 gi|386838844|ref|YP_006243902.1| gi|474981053|ref|YP_007691519.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]