SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2KWH6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2KWH6
Domain Number 1 Region: 319-396
Classification Level Classification E-value
Superfamily ApaG-like 0.00000000000301
Family ApaG-like 0.0033
Further Details:      
 
Domain Number 2 Region: 109-242
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000129
Family SMI1/KNR4-like 0.012
Further Details:      
 
Weak hits

Sequence:  H2KWH6
Domain Number - Region: 36-74
Classification Level Classification E-value
Superfamily F-box domain 0.000126
Family F-box domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2KWH6
Sequence length 421
Comment (tr|H2KWH6|H2KWH6_ORYSJ) Expressed protein {ECO:0000313|EMBL:ABG22441.1} OX=39947 OS=Oryza sativa subsp. japonica (Rice). GN=LOC_Os11g16390 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MAAPPQPQPEPEPAAGGAGLEALEGLALDTVIAKAGARQAAALACASTRLRDAAGDDALW
RRFCADDLALHAPLAPDGRALPSFKDAYKVWLESFGMYPLPLVRRVKIFWSSLKSWLSEN
FPEAHKTLNKGVSEAQIQSAEDDLGFKLPLPTKLLYRFCNGQLPLSEHHHENMRMAHLGI
IGGYVFYDHLINVHLSPLEQIVEETKEFYREFYDQGVFNMTNLIIVATSWYRPKTFFLNC
SDDQLYVGTINLQDGEMLPCVPKSLIRPTNTDMPQDGLLLWLEEHLRRLQNGMIKIRMLK
TSRYISLFPEASPSCTSAMTNGVKVRASAVFAPEHPESRRPGAKCLYAYSIRLSVPEACM
LGGVYYSSCQLYSRHWIIRWRDRVVSDVNGEGVIGKVCGKQEEHSINYVFLHAHIHFKRK
V
Download sequence
Identical sequences H2KWH6
LOC_Os11g16390.3|PACid:21948598 LOC_Os11g16390.3|13111.m01652|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]