SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2KZT6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H2KZT6
Domain Number - Region: 47-102
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0122
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number - Region: 14-63
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.0656
Family Leucine zipper domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2KZT6
Sequence length 106
Comment (tr|H2KZT6|H2KZT6_CAEEL) Uncharacterized protein {ECO:0000313|EMBL:CCD69726.1} KW=Complete proteome; Reference proteome OX=6239 OS=Caenorhabditis elegans. GN=CELE_F28E10.1 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MIDCLLAPIFSSFIRRSSNHAAAQNNANRNTQYIETSLDRQIDAGRSEVQDIKSQLQKLN
RLVNEMGVSGWEEELTRLRRENEQLRRELAERDATIAALQSQTVSS
Download sequence
Identical sequences H2KZT6
F28E10.1e NP_001255264.1.50509 F28E10.1e

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]