SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2KZU3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2KZU3
Domain Number 1 Region: 29-116
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.34e-29
Family Nuclear receptor 0.00032
Further Details:      
 
Domain Number 2 Region: 212-441
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.05e-22
Family Nuclear receptor ligand-binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2KZU3
Sequence length 446
Comment (tr|H2KZU3|H2KZU3_CAEEL) Nuclear Hormone Receptor family {ECO:0000313|EMBL:CCD69792.1} KW=Complete proteome; Reference proteome OX=6239 OS=Caenorhabditis elegans. GN=CELE_F21D12.1 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MGPRSKSTMRLMSKDSSQSLVANHKATLFCAVCGDTALGKHYGVTACNGCKGFFRRSIWK
NRTYACRYQGKCGVAKEQRNACRSCRLKECIKVGMNPRAVQGDIDTASTSSASPNLVSVE
MHPYTKEVECQTEVSTISSHPTSPSTLPFVSSGSSICSVSSSCSSVSTVYSNCLAMLPPN
PSLPKYDYLLASLSRIFERVDEHAPEPLPNTYSFEHAFYNPHLICNRTKLTPTGERIATL
PEVLQDFRRIFVLFTDVLSILPEFSRLDESDRMVLAKSRFSFFYWWLTCCWTAKVGCPGV
CYANGAYHPSDKRQQAFPDVKGVTELSVETVSKPLANINITDAEMLVGSVFAIFYEYPLP
PKVSYASTHILNEARDLYTQCMITVSPYSQLEAKSASRLAEISLIFSSITNLKYLTSDNI
ELSDVLHVMEVDQLITEAFDVHRPME
Download sequence
Identical sequences H2KZU3
NP_001022103.1.50509 F21D12.1d.1 F21D12.1d.2 F21D12.1d

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]