SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2L3A3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2L3A3
Domain Number 1 Region: 318-435
Classification Level Classification E-value
Superfamily TIMP-like 8.16e-17
Family Netrin-like domain (NTR/C345C module) 0.021
Further Details:      
 
Domain Number 2 Region: 2-48
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000209
Family TSP-1 type 1 repeat 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2L3A3
Sequence length 443
Comment (tr|H2L3A3|H2L3A3_ORYLA) ADAMTS like 5 {ECO:0000313|Ensembl:ENSORLP00000000215} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN= OC=Oryziinae; Oryzias.
Sequence
EWLPWSGWSVCSRTCGGGASVRTRTCITRNLVGRPCAGEPRQYKICNTKECPPGSQDFRE
MQCAVFNQRPLVAGNSFKWTTFHGGSNPCELSCMALGHNFYYNFGHVLDGTPCSDEGGVM
CVSGRCLKPGCDSILGSGQEDDACMVCGGHNSTCLQHRSIYKSNRLEAGGPFGYNQVAMI
PAGATHIRVTDNSRDYLALQNKHSQFVINGNWKISVPGEYSIAGTKLLYKRSADTWESFE
VPGPTQEDLHLMVLAMDRNSGIEYEYWLPPDLYALFHGGKSSLRQALHTTSFFQRSPSST
TPSASATSRPLLSTGRPHPRRCGKCLRVRGRRERRRQYCQKDFVFRGKVLEKVQSGKETR
YDVQIIHTYRNRFRLEHREFLWVPNVCDCPHLEGGRQYVFMARRHINYERTLNRILLEED
SYVVPYRPREDELLWTLEGLCSS
Download sequence
Identical sequences H2L3A3
ENSORLP00000000215 8090.ENSORLP00000000215 ENSORLP00000000215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]