SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2L3L4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2L3L4
Domain Number 1 Region: 284-333
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000955
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2L3L4
Sequence length 338
Comment (tr|H2L3L4|H2L3L4_ORYLA) Spondin 2b, extracellular matrix protein {ECO:0000313|Ensembl:ENSORLP00000000338} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN=spon2 OC=Oryziinae; Oryzias.
Sequence
METAMTALFLSGALCHLLVLMIGLSQGVHSVPVPTDLPMCTASEPAQYSLTFSGKWTRAA
FPKQYPVYRPPAQWSNLIGVTHSLDYHMWQRNEFASNGVREFAEKSEAWTLMKEVETAGE
RIQSVYGILSAPAVVGGTGQMDTEFEVFARHSLMSFMVRIIPSPDWFVGVDSINLCNGDK
WKESVTLELFPYDAGTDSGFTFSSPNFETIPQDRITQITSSYPSHPANSFFYPRLKHLPP
IAKVKLTKIKKTNQIISLPMEPTQSNLLPTGNEIEETLINTPLDCEVSVWSPWGLCKGKC
GESGVQHRTRYVIMHPANNGVACPLLEEERKCIPDNCL
Download sequence
Identical sequences H2L3L4
XP_004073065.1.28442 ENSORLP00000000338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]