SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2L564 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2L564
Domain Number 1 Region: 544-608,827-1168
Classification Level Classification E-value
Superfamily Ras GEF 1.09e-117
Family Ras GEF 0.00000999
Further Details:      
 
Domain Number 2 Region: 131-353
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.45e-43
Family DBL homology domain (DH-domain) 0.00026
Further Details:      
 
Domain Number 3 Region: 341-496
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000026
Family Pleckstrin-homology domain (PH domain) 0.032
Further Details:      
 
Weak hits

Sequence:  H2L564
Domain Number - Region: 3-51
Classification Level Classification E-value
Superfamily PH domain-like 0.00429
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2L564
Sequence length 1170
Comment (tr|H2L564|H2L564_ORYLA) Uncharacterized protein {ECO:0000313|Ensembl:ENSORLP00000000930} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN= OC=Oryziinae; Oryzias.
Sequence
MQHYFLVIFGHDGQKPLELRTDEESDCNEWVECIQQASYSDIIIEREILMQKYIHLVQIL
ETEKIAANQLRTQLEDQDTEIERLKAEIVVLNKTKERMLPYQNNQEEEDPDIKKIKKVQS
FMRGWICRRKWKIIVQDYICSPHAESMRKRNQIVFTMVEAEAEYVHQLSILVNCFLRPLR
MAASSKKPPISHDDVSSIFLNSETIMFLHEIFHQGLKARIASWPTLVLADLFDILLPMLN
IYQEFVRNHQYSLQVLANCKQNRDFDKLLKQYESNAACEGRMLETFLTYPMFQIPRYIIT
LHELLAHTPHEHVERKSLEFAKSKLEELSKMMHDEVSDTENIRKNLAIERMIVEGCDILL
DTSQTFVRQGSLIQLPSSSERGVLSKVRLGSLSLRKEGERQCFLFTKHFLICTRTSGGKL
HLLKGGTLSLIECTLIEELDASDEDYNAAGQGFSHLEFKIVVEPADGQSFSVVLLAPSRQ
EKAAWTSDISQCIDNIRCNGLMTSVFEENSKVSVPHMIKRSGEAQRRPRLLRSDARLHKD
DVDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSIDFLNTFLHTYRIFTTGAVVIDK
LADIYKKPFTSIPVRYVLSLEVFFATNQGAWGADPLNNKSPRLCRKFSLPQAFGVSSPPP
GSTKAPLDLSRGPSSPELSPAAAELNGGAGSLTSDQKSLLKSLVKKKKEPLPLTCTTKEG
VAEPHVAPEPPVAEPSAKKKIKRLSVKFIPESPSSGEPGDLSPCRSPSTPRHLRFRQSGG
GRLFAAAAAEGSRMSPASAFAIATAAAGHSSSQGEESWKHRRRSVLKPSFMNSEKGCDKE
FIIRRAATNRVLNVLRHWVSKHSQDFDMNSELKTGVMSLLEEVLRDPDLLPQERKATTNI
LSALSQEDQDDSQLRIEDILQMAESPKVECIESLSAMELAEQITLLDHIVFRSIPYEEFL
GQGWMKIDKSERTPFIMKTSQHFNDMSNLVASHIISHTDVGSRASSIDKWLAVADICRCL
NNYNGVLEITSALNRSAVYRLKKTWAKVCKQTKALMDRLQKIVSSEGRFKNLRETLKNCN
PPCVPYLGMYLTDLAFIEEGTPNFTEDGLVNFSKMRMISHIIREIRQFQQAPYRIEHQPK
VTQFLLDKAAVMDEDALYEVSLKLEPRVPP
Download sequence
Identical sequences H2L564
8090.ENSORLP00000000930 ENSORLP00000000930 ENSORLP00000000930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]