SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2L6Y9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2L6Y9
Domain Number 1 Region: 6-266
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3e-93
Family Eukaryotic proteases 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2L6Y9
Sequence length 282
Comment (tr|H2L6Y9|H2L6Y9_ORYLA) Uncharacterized protein {ECO:0000313|Ensembl:ENSORLP00000001597} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN= OC=Oryziinae; Oryzias.
Sequence
KSKSDCLILFSFFLIFIPESVAQLSDCGQANLNTRIVGGQDAPAGFWPWQVSLQTSAHFC
GGSLINNQWVLTAAHCFKSGSASGVNVVLGLQSLQGSNPNRVSRTVTTLIVHPNYNSVTA
DNDIALLQLSSQVTFNNYITPVCLPSTNSTFYSGVNTWVTGWGNIGTGVSLPAPQTLQEV
QVPIVGNRQCKCSYSSITDNMVCAGLLAGGKDSCQGDSGGPLVIKQNNRWIQAGVVSFGN
GCALPHFPGVYTRVSQYQTWINTQITTNQPGFITFTSTGTDS
Download sequence
Identical sequences H2L6Y9
ENSORLP00000001597 ENSORLP00000001597 8090.ENSORLP00000001597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]