SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2L7W9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H2L7W9
Domain Number - Region: 30-104
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0167
Family Classic zinc finger, C2H2 0.065
Further Details:      
 
Domain Number - Region: 56-85
Classification Level Classification E-value
Superfamily Recombination endonuclease VII, C-terminal and dimerization domains 0.0732
Family Recombination endonuclease VII, C-terminal and dimerization domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2L7W9
Sequence length 188
Comment (tr|H2L7W9|H2L7W9_ORYLA) Uncharacterized protein {ECO:0000313|Ensembl:ENSORLP00000001936} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN= OC=Oryziinae; Oryzias.
Sequence
MTKMQSDSTQFVTSEPNKEVCKFAAQPTVKSFQCGKCTLVFKSKVYLFEHLNNVHDLDVH
TALQDAGLKYAEADKNSSLEKKHFKCQHCDFKTCHQDLFKKHKKQCHQNENANLTEALSG
SENHEAAGVSADHHREAAELEEIPSVLSAASTSEAKCLLASLKDLKTYKRPAQTNENLFK
NPPGLNGT
Download sequence
Identical sequences H2L7W9
8090.ENSORLP00000001936 ENSORLP00000001936 ENSORLP00000001936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]