SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2L893 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2L893
Domain Number 1 Region: 323-401
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 5.93e-25
Family Intermediate filament protein, coiled coil region 0.0000633
Further Details:      
 
Domain Number 2 Region: 94-128
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000000000192
Family Intermediate filament protein, coiled coil region 0.00098
Further Details:      
 
Domain Number 3 Region: 100-208
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000759
Family Myosin rod fragments 0.018
Further Details:      
 
Weak hits

Sequence:  H2L893
Domain Number - Region: 249-304
Classification Level Classification E-value
Superfamily Apolipophorin-III 0.0575
Family Apolipophorin-III 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2L893
Sequence length 452
Comment (tr|H2L893|H2L893_ORYLA) Uncharacterized protein {ECO:0000313|Ensembl:ENSORLP00000002063} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN=LOC101171025 OC=Oryziinae; Oryzias.
Sequence
MSFGERYAVSSYQKIFGDSPRLPASSSSSRLSGGSPRGSPGLRSSMATARSGAPSLSLYR
RAGRSSTHFAPVPSGSLDLTQTSVVNNEFKIIRTNEKEQLQGLNDRFATFIDKVRQLEQQ
NKVLETELVTLRQKQSEPSRVAQLYQQELRELRSQLEEMNRDKGHILIEKNNMEDELQKV
IVKYEEEVRIREETEQTLRSFKKDVDNAAAIRLDLERRMETLMDEISFLKKVHEEEIEEL
SSMIGAQEVPVGLEPAKPDLTSALKEIRNQYESIASKNLQSAEEWYKSKFASLSEQATRS
TEAMRASREELTEFRRQLQSKTVEIETLRGANESLERQIGEMEDTHNAEITAMQDTINHL
DSELRNLKGEMAQHLREYQDLLNVKMALDIEIAAYRKLLEGEETHFNSGMSFGTASYNYQ
PRASAGPSKSSKKEKEGGTKESFKDVGEDKDE
Download sequence
Identical sequences H2L893
ENSORLP00000002063 ENSORLP00000002063 8090.ENSORLP00000002063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]