SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2L9N1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2L9N1
Domain Number 1 Region: 830-1066
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.71e-54
Family DBL homology domain (DH-domain) 0.0000251
Further Details:      
 
Domain Number 2 Region: 1064-1193
Classification Level Classification E-value
Superfamily PH domain-like 1.7e-36
Family Pleckstrin-homology domain (PH domain) 0.0007
Further Details:      
 
Domain Number 3 Region: 644-699
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000174
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.006
Further Details:      
 
Domain Number 4 Region: 158-220
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000249
Family Ankyrin repeat 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2L9N1
Sequence length 1552
Comment (tr|H2L9N1|H2L9N1_ORYLA) Rho guanine nucleotide exchange factor 28 {ECO:0000313|Ensembl:ENSORLP00000002575} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN=ARHGEF28 OC=Oryziinae; Oryzias.
Sequence
FKGSVFDLPLQGEAKVFALLEGLDSVPEDVEVYIVLDGSTLVHVTRAENDVMLCFIVPGH
NLPEMVSVQAYLCSDNMPLTWAGESSLEYVSDDAQEMAEHLVVHGHCLSSTDHKELSSLF
GLSQESSRWAVDRRVALAMANLDFPSQWNVLGTHSGNDCSPRESPLHLAVRWGLYRLAEL
LLCQPGGLMAVNLPNEEGVTPLQLAQKAGSTQLLKLLLEPPNPLATPPAGLSQVWVDQSR
LLRFCHDTGNLTLTARQNPRWSAPQSRRAHILILRHRLRDMDFLKEVMKKSAVTQKLPSF
YSEDIDEPLMFCLNEDPQGEKNDRRPMIQMGNGRVRCQQLSRFAFDQSLWNKESQASSPT
LAAVARLSAMMHGQDRVYANAMLVDQVDDADIRYRPPVFNGISSKTSLRSSKNKLAIKSC
RHHQTENVSKIRQPDIRLIFGCLKKMVTVTYTTPSVSSSVNVNLSCNLAHHNLCTCVFLC
VTSPSLECDSGDEDILGHSYPCSSIKHRSILHSISGEERGSFDASPDFNRSHSDITPKTI
KNSEDPEVRLRSYSYSSPKAKPSRPLLNRDMAITDLEEEQRAFSLTETPREKRIEDEEWD
KYIIPSKVETEKYKVSRTFSFLKNRMSSTRNKTKVKGKDMKEGKDRTGAMNGHQFVPVSQ
STPALCAACDKPVSGKELLQCSSCFVNVHKNCRESVAACGKTFAQKYYSKNSPNFLLCLM
KLQQERNAALVKSKTTSLPHKLPDSVKENCQASVFSSSSSSPSSTSSREKRETITHFSKS
LSMSLDSSSDDVLFVSRGLSDVAEADTSVDTVDASVLTELSADQLGLDAESWSLAVSPDF
CRKLDRFTIKRQDVIYELMQTELHHIQTLTVMSEVFRRGMLEELQLDLDCVARIFPCLDP
LLLFHRNLFRTLQERRQVSSHQENSQNYLIHQIGDILLQQFSDENAERMKQLYGEFCSHH
MEAVHVFKELQQQNKKLQNFVRQQSNNSLVRRREVPEFILLVTQRITKYPVLLERILQHT
QEGSQEHLDLSNALAQIRDIIAAVDLTVNNYEKCQELQEVLARLDIKSFAKLKNGKVFRK
QDLHSKHRNLQHKGLVFWKTATGRLKDTLALLLTDVLVFLQEKDQRFIFASVDQKPPVIP
LQKLIVREVANEERGMFLISASSAGPEMYEVHTTTREERNAWMKHIRQAVESCPEEEEEE
ERNTETEEARHAAEVRIQKINKFQDALFRQDQRICHSLEEKLQLYAEFAELTLPSPEPSP
HRHLLVQPAQLSDCETPRQALNLVTAALREGQKAAAWVHGSQTQNGFSTQSQSPPAGGPD
CCSYSSHGGSVQESPSEHYLNTLSMSSTSLGSDSESAGLDNVSWSPASEFRKGDKGTLLK
VAESVQNMTQLLYSLQAAVTFQDSCYEVYKLLLLKGEKYQLRNFASLQNNLVPTINHSYF
LKKYVFLLTKEVQKLHAKLKQEQLRWDKECLAREKQQTEQESVLEQREQQCFLEMERLRC
EREQLEAQLLEYQQNLDRLKEGQRTVELERKKIETQQRLLQSWRHSRQSSLP
Download sequence
Identical sequences H2L9N1
ENSORLP00000002575 ENSORLP00000002575 8090.ENSORLP00000002575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]