SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2LA22 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2LA22
Domain Number 1 Region: 162-196
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000952
Family HkH motif-containing C2H2 finger 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2LA22
Sequence length 207
Comment (tr|H2LA22|H2LA22_ORYLA) Uncharacterized protein {ECO:0000313|Ensembl:ENSORLP00000002726} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN= OC=Oryziinae; Oryzias.
Sequence
AQPEPGTPSQPEPGTPSQPEPGTPSQPEPGTPSQPEPDASVPPPLDSAPEVELPPEASAD
SSSQSVNEDAVTAERKEENESAHPLESQAEKEVDVLDSKEEQECTSEEEKNGAEGQSEST
EAVKPQNTDDHVTKETTTTAELPLPPYDPHQPVGMEYLIPKTGFFCKACSRFFTGDKAME
ISHCKTRKHYESLQKFLQTKASSVKTD
Download sequence
Identical sequences H2LA22
ENSORLP00000002726 ENSORLP00000002726 8090.ENSORLP00000002726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]