SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2LAM5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2LAM5
Domain Number 1 Region: 350-593
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.06e-71
Family Eukaryotic proteases 0.0013
Further Details:      
 
Domain Number 2 Region: 126-231
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000419
Family Scavenger receptor cysteine-rich (SRCR) domain 0.01
Further Details:      
 
Domain Number 3 Region: 268-305
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000367
Family LDL receptor-like module 0.0032
Further Details:      
 
Domain Number 4 Region: 235-266
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000111
Family LDL receptor-like module 0.0025
Further Details:      
 
Weak hits

Sequence:  H2LAM5
Domain Number - Region: 53-104
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000229
Family Ovomucoid domain III-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2LAM5
Sequence length 602
Comment (tr|H2LAM5|H2LAM5_ORYLA) Uncharacterized protein {ECO:0000313|Ensembl:ENSORLP00000002937} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN= OC=Oryziinae; Oryzias.
Sequence
MSTRRISSSLLLLFLLILCSGAVYASTFSPAGGDLSQKFRIEKRLTRASCGRVFCSPWQR
CIDGVCSCKPPYMCPRDGVKAVCTRNHKRYLSYCQAMAMSCTTKKVHASSFIAESVKKFS
SSIDKQTGVVKLFLPDDGVGEELLVCHGQWNMAAANVACSFLGDIFTCRGAASAFAVNYS
QISGGAEPLPRRCVNVRCQGFEFSLAECEIYNRVDIGDGAVAAARCYDSRPPEDCGFTCA
NDKCVSLNQTCDGVDDCGDRSDEMCCKKCRNRAFRCNTGVCVHPDAVGDHQLDCLGGEDE
TPKHLNTIDFLNFMDKNKSILTSDWSVYKKRIIKNMIPNMDLVDETEEHVRGRISRKKRV
VGGVEAKPTQIQWQVALQEHGRIDCGGAYVGGCWVITAAHCVRRNPAAFKVKFSLWKKYA
PQGSTDIVPVEEIIIHPNYNPATYENDIALVKLKKYPYRDYCVEENPAIRAVCVPWSIEL
FQPNYTCSISGWGRTKTGKSAEVLLWANVSLIEGCQSSYKHRFKAGMMCAGDLDGNVDSC
QGDSGGPLVCQDQLGVSYLWGIVSWGDKCGKRGYPGVYTQVAYFFEWIRSHTGWPAVTKF
NS
Download sequence
Identical sequences H2LAM5
8090.ENSORLP00000002937 ENSORLP00000002937 ENSORLP00000002937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]