SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2LBH3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2LBH3
Domain Number 1 Region: 67-192
Classification Level Classification E-value
Superfamily PH domain-like 9.84e-35
Family Phosphotyrosine-binding domain (PTB) 0.0000697
Further Details:      
 
Weak hits

Sequence:  H2LBH3
Domain Number - Region: 1-47
Classification Level Classification E-value
Superfamily SH2 domain 0.000287
Family SH2 domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2LBH3
Sequence length 198
Comment (tr|H2LBH3|H2LBH3_ORYLA) Uncharacterized protein {ECO:0000313|Ensembl:ENSORLP00000003246} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN= OC=Oryziinae; Oryzias.
Sequence
HFLIESSAKGVRIKGSSQEPFFGSLSALVYQHTVSPYALPCRLVLHSQEFTSACPPPTVG
SECLMNLSPACNFVYLDAVPTEMLTGPCAVQKAVTSMLEKASGSFTPALVNLKVSGKGVT
LTDINRRLFFRRHYPTHLLSYGGEDPDGRFLCSHRMFGFVAKSMEAGVENVCHVFAEHDP
LQPCSTAIHFIQAAINKQ
Download sequence
Identical sequences H2LBH3
ENSORLP00000003246 ENSORLP00000003246 8090.ENSORLP00000003246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]