SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2LBP4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2LBP4
Domain Number 1 Region: 369-501
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-37
Family SPRY domain 0.0012
Further Details:      
 
Domain Number 2 Region: 10-82
Classification Level Classification E-value
Superfamily RING/U-box 2.87e-20
Family RING finger domain, C3HC4 0.0079
Further Details:      
 
Domain Number 3 Region: 139-205
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 7.78e-17
Family B-box zinc-binding domain 0.00062
Further Details:      
 
Weak hits

Sequence:  H2LBP4
Domain Number - Region: 193-345
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0157
Family FCH domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2LBP4
Sequence length 501
Comment (tr|H2LBP4|H2LBP4_ORYLA) Uncharacterized protein {ECO:0000313|Ensembl:ENSORLP00000003320} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN= OC=Oryziinae; Oryzias.
Sequence
MAQRGLLLDQENLSCSICLDVLKEPVTVPCGHSYCMDCIKTHWDEDDQRGNHSCPQCRKT
FFLRPVLEKNIMLAELVEELKKTELRSDLCYAGPEDVSCDVCSGRKMKAVKSCLDCLASY
CEEHLQPHSVAPALQKHKLVDPSRNLQQNICSLHDEVMKIYCRTDQQNICYLCLMDEHKG
HETVSAATERMEKQKKLQETRQQIQQKIQDCAQAVKELQQEVEDINTAADKSVEDSEEIF
SEMIRLLQNRSSEVKQQIRSQQDDEVNRVLDLQEKLEQEIRDLKSKDREMEQLSHTEDHS
QCLHRYPSLSALSESTHSSSFHLSPLRYFEEVTAAVADTRDKLQELLRDSWTNITLTVDV
LPPKPEPKTRDVTLDPNTANVHLSLSEGNRKAEVMKQKLYYSRHPDRFTVCPQVLSRERL
TGRCYWEVEWGGQALYVTVAYKDTPRSGDCLFGWNDRSWALYYGINVYQFCCNKVLTPLS
GPSSTRVGVYLDHGAGVLAFY
Download sequence
Identical sequences H2LBP4
8090.ENSORLP00000003320 ENSORLP00000003320 ENSORLP00000003320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]