SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2LDQ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2LDQ5
Domain Number 1 Region: 681-731
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000219
Family Erythroid transcription factor GATA-1 0.0024
Further Details:      
 
Weak hits

Sequence:  H2LDQ5
Domain Number - Region: 1015-1062
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00069
Family Classic zinc finger, C2H2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2LDQ5
Sequence length 1081
Comment (tr|H2LDQ5|H2LDQ5_ORYLA) Trichorhinophalangeal syndrome I {ECO:0000313|Ensembl:ENSORLP00000004068} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN= OC=Oryziinae; Oryzias.
Sequence
SPKLQDFKCNVCGYGYYGNDPADLVKHFRKYHLGLHNRTRQDAALDTHILALHNMAPSLG
NFCSSFSVIRFFLLVLVLNKNPQHRTVVMNGTYDVQVTLGGMLIGIGRKTSDCQGNTKYF
RCKYCNFTYMGSSSSELEQHFLSSHPNKVKTPPTTPMTAANNLVTHDNQLKGRIQNSESV
ERVAVRADDDALAGYCIPGGACSDSLAWTGEDGRGATQAYYLCKSCSWSCEWSGGSAKLL
EHYEQRHRGSPGGAVSPNNTISAGTERGGRRDGVEKDYVVFKSCKDQLPNPSSTSKGDPN
CSDSDPVVTSYNCQLCDFRYSMAHNADVIVVAPLLLHYQHNHSIHRCCIQHCVYCPQGHC
QPHKHLGEVSHPFACRKSTCPKCCSKFPQLTKQQDAITCVTHLCDQCAFATTDIDVLLQH
YESCHTLINLKGVAPRVKAEEKAEGDKEEGKRRGRERQYSCAKCHFITEVEEEIFRHYRR
VHACCRCRHCDFTAPDSSALLDHFNSSHCHDSTPASGSLPTTLTPSIKEESKGDLRLLYS
LAPPEGGLAEGGREEACRAVKSERGDDKEREREKGWVLGEARGLGERGGEQAHGLLCYTN
VSLGFLIPLCKSEWASTPLRPSASALASHSLLNLDGLVVDFCLLASSMPEGKEKAMELTK
QISLPGESELRDETQKISHRRRGSGVFCANCLTTKTSLWRKNANGGYVCNACGLYQKLHS
TPRPLNIIKQNNGEQIIRRRTRKRLNADSLSSETPPSKQQRISSEERLNGEESERSCAPL
KGQQPSPRSRSPRSTQAFLASQTLEIHRRMPPLLLPSHTPSAMAAEGNGGITEGGIPSKM
DGGKGGGGSERGSPIEKYMRPSKPSSYSPPGSPIEKYQYPLFSLPLPLAISPDLTPESDW
LRFWTKYKMAATASGIPGNISNLSSPSSLGNNPNYLDYTSPNNTQTSSSTLLENEGPLDL
AIKQRDASGANTNVSTNGQERRLRDSPLSEKETGNWKKEKEEAVDVATQDDLTSRCIHCG
ICFLDEVMYALHMSCHGDKGPYQCSFCQHMCVDRYDFTTHIQRGLHRYTDKMSQQRGHTQ
E
Download sequence
Identical sequences H2LDQ5
8090.ENSORLP00000004068 ENSORLP00000004068 ENSORLP00000004068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]