SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2LDS4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2LDS4
Domain Number 1 Region: 339-472
Classification Level Classification E-value
Superfamily C-type lectin-like 3.71e-39
Family C-type lectin domain 0.00013
Further Details:      
 
Domain Number 2 Region: 198-331
Classification Level Classification E-value
Superfamily C-type lectin-like 1.42e-36
Family C-type lectin domain 0.0005
Further Details:      
 
Domain Number 3 Region: 930-1080
Classification Level Classification E-value
Superfamily C-type lectin-like 7.46e-34
Family C-type lectin domain 0.00062
Further Details:      
 
Domain Number 4 Region: 789-916
Classification Level Classification E-value
Superfamily C-type lectin-like 1.08e-33
Family C-type lectin domain 0.00082
Further Details:      
 
Domain Number 5 Region: 633-774
Classification Level Classification E-value
Superfamily C-type lectin-like 1.31e-30
Family C-type lectin domain 0.00043
Further Details:      
 
Domain Number 6 Region: 483-619
Classification Level Classification E-value
Superfamily C-type lectin-like 3.37e-29
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 7 Region: 1098-1212
Classification Level Classification E-value
Superfamily C-type lectin-like 4.37e-26
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 8 Region: 1222-1358
Classification Level Classification E-value
Superfamily C-type lectin-like 2.97e-22
Family C-type lectin domain 0.003
Further Details:      
 
Domain Number 9 Region: 135-193
Classification Level Classification E-value
Superfamily Kringle-like 2.77e-21
Family Fibronectin type II module 0.00076
Further Details:      
 
Domain Number 10 Region: 8-135
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.0000000000000158
Family Cysteine rich domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2LDS4
Sequence length 1442
Comment (tr|H2LDS4|H2LDS4_ORYLA) Mannose receptor, C type 2 {ECO:0000313|Ensembl:ENSORLP00000004088} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN=mrc2 OC=Oryziinae; Oryzias.
Sequence
STALPESDDFAFILDGANVCLGVMDKSLSLKSNCEEPLQRWKWVSRGRLFNLGSSLCLGI
TTANVTSSMEAYPLGVYTCDREPPRVGWTWNCEQVLDIFNSIHTTSLRNSSFTASSLMLK
WKLHGDVQDLCSKKYQDIYTIQGNSQGRPCHLPFLYDGQWFHNCTSIGREDGHLWCATTY
DYGQDERWGFCPIKSSSCETFWDTDPLTDSCYQFNFQAALSWSEARISCQQQGADLLSVT
KLHEQTYINGLLTGYSAALWIGLNDLDISGGWQWSDSSPLKYLNWEKEQPNHADEENCVV
IRTESSGRWQNRDCSVDLPYVCKKRPNATMDPFTTDSWTDDEKYECDVGWQAFQAGCYKL
NSEKTDWNAAQKNCQKVEANLASIHTLPELEFITRSLRKDIDQLWIGLHDTDMQMDFQWT
DHTPVIFTYWHPFEPNNFRNTPEDCVSIWGAEGRWDDSPCNLTLPSICKKPGTKSDGKPQ
QQDCNQGWKWHSPACYWVGEDLLTFEDAKKSCESHQAALVPITNRLQRFEQAFANSLVFG
RSGESFWIGLYDQGSPGSFHWLSGDGVSYTNWNRNEPAKIQSGCVAMATGIATGLWEVKE
CASAKAKFICRQNQDTSLSPEPPAPLPTPSLSGSCPSGWKSNSNLRYCYKVFHSSQMENR
LSWLDAHLFCRRHGAHLLSISGPDEEHFVLQVLHEAFGKEESEEHEQHWFWIGLNRRNPM
DNGSWKWSDGMAVTYQNFGRYYYNVRQCAAADLGAMTWLAMHCDSELDWICKIPRGSVEK
LPEITEGNTSPEWIMFKEAEYKFFDHRTTWDQAQRICSWFDSSLASVHSADEQMFLANTL
RKMVKVEGDSWWLGLHTYENDGRFRWSDHSVLNYISWALGRPHPLSRDRRCVSISASKVD
WSDQKCHSDLPYICKRVNVTGTVPPTPSTPHPPSGCPDGWASYQHKCFKVFDQSPRVTWS
AAKLKCDTQGGVLAVVSSPLEQAFVTTLLKYISADLWVGLTSDPKGHFQWAQAGLLSYTN
WAPGEPLDNSGPHHNKTPGNCVVMIHGNPEKKVGMWASKACEMENNGFICQKQQDRGLPP
APPLIPSSLSKPVELGGVTYRVVKKRLDWTSSLHICESLNGTLATVKDPYQQAYLTLLMN
SLHQPAWIALYNYGGRSFTWLGNEDVVYSNWKDGEPNQMAGCGHMTTTGQWTMTPCDSKL
ETVICQIANESVSHQWTYPGQCPHSLGEWAWVHFRNHCYAFNLQSLKLQQDAHKSCKKIG
AELLSIMDEAENGFIWEHIQSYAEQAHGAWLGVKCAPVGRGLVWDEDKEMLYTNWETHNV
AFSVLSINSCFWIQSNSGFWKPGSCRNRTHGVICKRPRSENAQTLHLHPVDTDHVPTIIV
AVVTGMLLVLLTVTVIYLYRRRNMGSQGSYKGARYSRTNSNLAEQTEKNILVSDMELNEQ
PE
Download sequence
Identical sequences H2LDS4
8090.ENSORLP00000004088 ENSORLP00000004088 ENSORLP00000004088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]