SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2LDV8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2LDV8
Domain Number 1 Region: 1158-1207
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-16
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 2 Region: 99-149
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000157
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 872-919
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000033
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Domain Number 4 Region: 353-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000703
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 5 Region: 460-508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000132
Family Classic zinc finger, C2H2 0.034
Further Details:      
 
Domain Number 6 Region: 1108-1166
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000196
Family Classic zinc finger, C2H2 0.039
Further Details:      
 
Domain Number 7 Region: 67-107
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000317
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 8 Region: 403-432
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000506
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Weak hits

Sequence:  H2LDV8
Domain Number - Region: 216-260
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0002
Family Classic zinc finger, C2H2 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2LDV8
Sequence length 1246
Comment (tr|H2LDV8|H2LDV8_ORYLA) Uncharacterized protein {ECO:0000313|Ensembl:ENSORLP00000004122} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN= OC=Oryziinae; Oryzias.
Sequence
VLENAKEAAGGEELSSINAMMSAVMSAAGTINGGDADNESGAASGNSSAGPSPSNRMNQD
AKDDSSAYICPLCDKNCQTQHQLTMHIRQHNADTGATDHSCSICGKCLSSASSLDRHMLV
HSGERPYKCSVCGQTFTTNGNMHRHMKIHEKDPASGLLPISSPPSPTKRRRPSVKRRQAQ
EEENEDEPQSKKVMEDGVAEEEAVGAGLGSEEELLPCPICFKTCSSRLDLDAHMDSHPDT
ALRCDLCCLSFRTHRGLLRHNAGVHKLLPQDPNGRPFIQNNPSIPTGFNDLAFIDFSCKK
FAQIAQVWCETNLRRCISKFHRFVYSPPMNEEAGHGGRKPGTKGGASTGSVKGSYPCRFC
NEVFAFSGVLQAHMRFHLGILPHQCNICDYVAPDKATLIRHLRTHSGERPYVCRVCHYPF
TVKANCERHLRKKHAKTSRKDIEKNIKYDSETGCGGAETTCRFCGEDLKSYRALQIHLRT
HNGCQKKPFECRRCGAAFLAKRNCIHHLLKQHPEVQEREIEEHIATLLPASAAVMAARTA
PPNGLSPAQVLSAVKVEELPHLVYPADLDQPLDFSAKGLGSRGGSPAVKVESFDCSALDQ
PIDLSIPSKRQRREAGPDRADIKTEQSGGLEQTHAVTSSKDEKVMSGLHPHPQLGCYQLP
PGSTPPPTPLAGPARAQRLKPLLPKPASSTASPPSLKELPPLASIAQIISSVSTAQDLLK
REAPSLDAKPHLPTASVNPPVDASGAAAAHSEEAPDGRYVTSPGPPSPPLSQADSCSSLR
RRSRKKPASVGGKEKPGAIDLESSGEFASVEKMLATTDANKFSPFLKTGAGDLAGKRGGA
EEKEGGAAEEVKPTAPQSKGKKNAYSNSVQKMTCPFCPRVFPWASSLQRHMLTHTGQKPF
PCPRCDAFFSTKSNCERHLLRKHGVTHRTLRRNGIIEKKDGDEGSHESAESQSETEQVTP
EAQVNVDANPAPAGDNPSPCEGTQELSGPADSSLSAEQLQEETPEQLDQQEAPEPPAAPA
KQHLPTGKVESTDDEDCHSNKSLDLNFGKKLIDFKLTTSSSGSAPQDEQPASSSPPSGSA
TPEPTETPEEKEKLTASPSPACSSALRSESKHVCHVCRKSFRYATTLARHERAHVSEETP
ADEAPPMKKEEPTESKAICSVCGKRFWSLQDLTRHMRSHTGERPYKCQTCERTFTLKHSL
VRHQRIHQKLRGADGSSAANDDASEDGDSCTPTPTSTCPPSENESE
Download sequence
Identical sequences H2LDV8
ENSORLP00000004122 ENSORLP00000004122 8090.ENSORLP00000004122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]