SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2LEU5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H2LEU5
Domain Number - Region: 203-230
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000571
Family Classic zinc finger, C2H2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2LEU5
Sequence length 860
Comment (tr|H2LEU5|H2LEU5_ORYLA) DAZ interacting zinc finger protein 1 {ECO:0000313|Ensembl:ENSORLP00000004471} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN= OC=Oryziinae; Oryzias.
Sequence
MLAEQRRNFVSQPFHDGVYYPYTSDTHGTHSSAGIPSLLNSPLSQPSAPGMTPSSGVSSI
LPFKFRPRRESVDWRRINAVDIDSVVSQLDVDALQEHVSTVTFCSLDGERCQRCQSPVDP
ALIKLLQLAQLTVEWLLHCQDFLSLSLRAAEERMAAAGREREELLDQMRKQEEKLKNLTA
ELKQRKKVIRAQQSLLTPRIISSHKCAHCDKSFLNSAFLTNHMQRRHPDELSAQLQSDKK
SQIESLKLEIGALKEQIAQQQEALAAKIVQEKEQESVHKDLLRELGRMDRKIEDSRDGIR
REMELLYSRNIQALNVREGPSFSTLPPPLYSDSRFRLNFQEANQNQSKQEKQASPENPPP
ERDVDAFRDIHLQQMKKKEKKWQSRLQEMQAQHASEKNQLQDELSSMSEKLETSQREQQG
MKRRLQEQEQTIQAQGEQIKDFSLLPPNSPSITRKLLWVSVNRSPPAAEPKPKHVVLARL
PTTCSSCAALLEEPVSTLTLDPIQELSEEDKVKVSEQEDIQSNKLNSKAALKVGASVKRD
TRLELERSVAKKLESLGVKAKLSSLKSKELTSVMSKVRAKREMTAKKMPEYWRHHEEILR
IVEKKAFLSFPVVKIRPRSSSLPSTARQPRTPQPAPRTRTSTQPKTSTPNPKAPRVINDG
SFRDVFGRKQKLFFIASIRSHPFSSDESEEEDMEEEDASKPPTSRSHPPTRAGRFAPVLT
RQEEARPAADAVTRADIEDTESEEEEEETSINEMARKIEKFAERVVKKPAGGVSVLPTRK
DEVEEISLTDLEGGSDWVISKPASLHGSGPTRRSMDSPSTSVWGTSTGKGPKSDLTDAGT
GSTLKSSICSVSDLSDSDDF
Download sequence
Identical sequences H2LEU5
ENSORLP00000004471 8090.ENSORLP00000004471 ENSORLP00000004471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]