SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2LH02 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2LH02
Domain Number 1 Region: 351-487
Classification Level Classification E-value
Superfamily C-type lectin-like 2.1e-27
Family C-type lectin domain 0.00083
Further Details:      
 
Domain Number 2 Region: 225-348
Classification Level Classification E-value
Superfamily C-type lectin-like 5.77e-27
Family C-type lectin domain 0.0017
Further Details:      
 
Domain Number 3 Region: 1412-1541
Classification Level Classification E-value
Superfamily C-type lectin-like 5.29e-26
Family C-type lectin domain 0.002
Further Details:      
 
Domain Number 4 Region: 633-794
Classification Level Classification E-value
Superfamily C-type lectin-like 1.12e-25
Family C-type lectin domain 0.0015
Further Details:      
 
Domain Number 5 Region: 956-1103
Classification Level Classification E-value
Superfamily C-type lectin-like 5.95e-24
Family C-type lectin domain 0.0026
Further Details:      
 
Domain Number 6 Region: 1119-1238
Classification Level Classification E-value
Superfamily C-type lectin-like 3.85e-23
Family C-type lectin domain 0.0024
Further Details:      
 
Domain Number 7 Region: 498-632
Classification Level Classification E-value
Superfamily C-type lectin-like 1.75e-22
Family C-type lectin domain 0.0015
Further Details:      
 
Domain Number 8 Region: 1562-1701
Classification Level Classification E-value
Superfamily C-type lectin-like 5.77e-22
Family C-type lectin domain 0.0015
Further Details:      
 
Domain Number 9 Region: 34-155
Classification Level Classification E-value
Superfamily Ricin B-like lectins 6.98e-22
Family Cysteine rich domain 0.0089
Further Details:      
 
Domain Number 10 Region: 1251-1376
Classification Level Classification E-value
Superfamily C-type lectin-like 1.92e-19
Family C-type lectin domain 0.0022
Further Details:      
 
Domain Number 11 Region: 154-211
Classification Level Classification E-value
Superfamily Kringle-like 4.57e-16
Family Fibronectin type II module 0.0021
Further Details:      
 
Domain Number 12 Region: 817-939
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000309
Family C-type lectin domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2LH02
Sequence length 1758
Comment (tr|H2LH02|H2LH02_ORYLA) Lymphocyte antigen 75 {ECO:0000313|Ensembl:ENSORLP00000005255} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN=LOC101158591 OC=Oryziinae; Oryzias.
Sequence
WRSRQVRPGILISTLLDKSTCQEILKFSKYEDEDDFSIQHSRTSTCLSAQTPAVLHLTTC
DPKDSSQRWKWSSAHRLFHVDTSLCLAMDLPSKKVSITDCGSTDPTWWHCADGALFTAYQ
MGLSVSEGNLVAKRNSNDTWVIGGSQSNICTKSYRVVHTTDGNSAGLPCEFPFKYNGSWH
HQCLPDPDLPGWSWCATTVDFDQDQKKGQCLIPEEDCHTLFEGPVGDSCYEFVATAAVTW
HAALDSCRSQGADLLSLSDIDNLTMFSGFRMMPIKMWIGLHQLDTSQGWQWSDGSPLSFL
RWEKDMPPTSLLIEADCGVLNSQQNYEAESCNKRLPYICKKRLNHTDTASLIYNNTACED
GWVPWSGFCYKLVKDVPKNFTDASNHCSVSEGGALLASFHSIDSKELISTNFHSDSSILE
VWIGLSGVGLNPTTFKWTDQKPLTFTYWDQKQPMQPSQSSSCVFYSGKSHRWRVGDCTQK
KPFMCQKEGKLKESPAVVGCSFKDGWRRHGNSCYKVNTEQVPFKDHCNITIRNRFEQAFI
NRLLGEHIKAEPQYFWIALQDIKNTGEYQWISPDGSPGVVTYTNWGWANPAQDGGCVVIT
TRKPLGSWEVKNCTLFKAGTICKKDLSPPPSPEPEPNPNATCSDGWVSRQGIKYCYKVFH
EERVSRKRSWEEARRFCQALGADLPSFTNVTEMLALHSIMRETISNNRFFWVGLNRRNPD
GFSWQWSDGRPVSMDVLHQDFLEDDEYSRDCTAFKLFSLYSYCPMEIWVHFFERSFYARP
FHCDAQLEWVCQIPRGIDPKKPEWYNPGEDGHHETSIFVDGSEFWFVKEPKLAFQEAMLY
CNQNGSKLAVLLSSTAASKVQWELQQLADSKQNWWIDMSYTQRSSDHFSLLGRCTALSPD
NTLSRESHINLKAKNVLHHEKNAKKLSCLQQFPFVCERHNITSVERNPLIPQPGGTSCKA
NALPFRNKCYTLMVKPDEPKPFKAANDDCQSVGGTLVTIADQVEQDFISTLLPKMKNMGK
IWIGLKIRPGESSWVDQSPITYLNFNPLLLGMQRDINPINLESLDMCVFLINNGSSEMLG
TWDYSSCNLPQSLGICQHYAGRCERSLRPWHDKVEPVVSKELFKVNGQTFQLIFQNLTWF
EALHECKRLGMNLSSVSDVLVQSSLSVYVSQAQTPMWIGLHSKDGGLNFVWADHSHTVYS
RWSPEASEGFCVYLDTDGFWKATECLEELGGAICYKPNSKAAPAISVMQTSVKCPHTRNG
PNWIPWGKNCYTFQLVPSRWDSFQSDQIGDTCTKLHPDADILTIRNEEENEFVRSTLQNF
QSLVQFVWLGIFKDDVDNQTRWYDGTIVQYSKWARGRPYLDSSFMAGLTTDGTWILITSE
NNYAEFKQKTIVSCKLDNDFEEVKQEYNRSAKDFQHYGSLTYEVLTRRLNWYQAVQECSQ
HGGHLASIHDFKHNSHIKLLAKTDGFKLWIGLSNVSSGAYGWSDGTKFDYSHNGFGAQGG
SSSGQLEPSCVFISPNGTWMNTSCNTVMDGAICYTTAVTTPTQRAKLKTAPENNRCPQSK
GESSWVQHQDHCYAFDMMFYNYSVYNMEEANAICQKMDLLTEAQLLTIKTKEENDFLAKY
LNDDFLITTQIWLSVKLDSQGKPLSWQDGSDLAYSNWKSEATLSGKSVEPPCAIMMAADG
GVWNLVSCKSSRSRVVCKTQAESAGSPVALGLFIVVFIALVLTIAYIIKKKRHYFIPTIR
YQRTLDQSDGTSIITDAD
Download sequence
Identical sequences H2LH02
ENSORLP00000005255 8090.ENSORLP00000005255 ENSORLP00000005255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]