SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2LH64 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2LH64
Domain Number 1 Region: 207-426
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.94e-61
Family DBL homology domain (DH-domain) 0.0000441
Further Details:      
 
Domain Number 2 Region: 416-559
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000104
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 
Domain Number 3 Region: 566-627
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000197
Family SH3-domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2LH64
Sequence length 645
Comment (tr|H2LH64|H2LH64_ORYLA) Rho guanine nucleotide exchange factor (GEF) 16 {ECO:0000313|Ensembl:ENSORLP00000005319} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN=arhgef16 OC=Oryziinae; Oryzias.
Sequence
MEPHEVVLSTESRAVQKMGTHQLIPKTLASRPKNRYHTTVVTFPVRLEKSSGDSSGESHS
RHSAQVPDVPWEDYDSDGDGFDLRRNRRNRSYRAAVTSLDVEAMMSAERAPVSTLKSVNE
VRASSPGPSHTVGRKFTTRTLGRKKDHRGSFKDATPCLYQEMRERGLHSTNQDELLDDFV
VVETPVEDQGIVVKNYKPAQLTWSQLPQVKNSDILSRITPQERKRQEAIFEIICSEHSYL
HSLGILVRHFKNSKTLSKTMAPTEHHHLFSNISVILKVSQRFFEDLERRHQEDVVIRDIS
DIIQNHAAHHFEPYIAYCSNETFQQRTHQKLLNTNSAFKEALKQLESSSECGGLPMFSFL
ILPMQRVTRLPLLLDTICQKTPENTAEYFAAVWALHAMSKLVTSCNDGARRMERTEQMYT
IQKQMDFGKIKPFPLVSSSRWLKKRGELNISAEELSIWKAFTNRSYYLFLFNDVLIVTKK
KTEEIFVVLDYATLENVEVEYVMETDGQMSSPTKSTPLTFKLLMTKNSDGRSEQISLVAD
SRVDRARWIIALTEHKQANATCTEGGLPQYEATKSYIPKEPDEIGLRQAELVLVMKKEEA
WCYAERMRDGERGWFPASCATEITNPTAMESNVQQMKRLRKETNV
Download sequence
Identical sequences H2LH64
ENSORLP00000005319 8090.ENSORLP00000005319 ENSORLP00000005319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]