SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2LHK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2LHK5
Domain Number 1 Region: 10-258
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.84e-70
Family Eukaryotic proteases 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2LHK5
Sequence length 261
Comment (tr|H2LHK5|H2LHK5_ORYLA) Uncharacterized protein {ECO:0000313|Ensembl:ENSORLP00000005468} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN=LOC101163477 OC=Oryziinae; Oryzias.
Sequence
TDLATMHDLMLLSFLLCLGTKAAAADGSEIVNGIEVPDGKMPYMVSVQNATDHICGGFLY
NEEFVITAAHCDSEKARVSHVVLGSNNLNNINKTMRIKIKKCKHEDYTKTASGHDIMLLQ
LTKKVKLSNKVEQIKLPKSGTNVSANTKCTVAGWGKTETRGKVMKKLRMVEVSVIDLNQC
KRVWKKSNGNFPNNIVCAGGYKVKQGFCQGDSGGPLVCDETAVGIVSFNSNHDCDYPKLP
NVYTDVSKYIDWIKKTVKQKK
Download sequence
Identical sequences H2LHK5
ENSORLP00000005468 ENSORLP00000005468 8090.ENSORLP00000005468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]