SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2LHT4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2LHT4
Domain Number 1 Region: 1239-1400
Classification Level Classification E-value
Superfamily PH domain-like 7.46e-67
Family Pleckstrin-homology domain (PH domain) 0.000000572
Further Details:      
 
Domain Number 2 Region: 1035-1243
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-54
Family DBL homology domain (DH-domain) 0.0000000319
Further Details:      
 
Domain Number 3 Region: 421-531
Classification Level Classification E-value
Superfamily PH domain-like 5.25e-18
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 4 Region: 832-906
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000024
Family Interleukin 16 0.088
Further Details:      
 
Weak hits

Sequence:  H2LHT4
Domain Number - Region: 753-793
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0234
Family UBX domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2LHT4
Sequence length 1607
Comment (tr|H2LHT4|H2LHT4_ORYLA) T-cell lymphoma invasion and metastasis 1a {ECO:0000313|Ensembl:ENSORLP00000005549} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN= OC=Oryziinae; Oryzias.
Sequence
MGNAESQDGVRNYYGDGAGHLSRKHTSRSFRLYNTHGVPRRPTHSSSLNQEHRNSATSTR
SSSTPSIPQSLVENGLEPFNATDELSEFGVNPHWTQRVAMTMRPESYQHDEDPLATPTPE
TSEADTVPQDGGEDSEGEGEAAGEERYLQRVTEGSRDGGNFKKKRSKSADMWREDSLEFS
LSDLSPEHLTSTEEMIDGGEEEEEEQFTCPRGGASSERASSLDHLCSHSPGLRGQSGRYI
KSHRVECNGDGQEDGLMSPNEEDGGGYEAFTLPCRRSHCLSEGLSMLGISNAPCPAFQGR
RAQTTQNISGVLSEGSEYEDSGIDGVAADGDGELVGRRCKAMSASFSVYSATESCVFNGS
DSGSSSVYENFRKELNSQRNQGRDCLEEAGSAVSDEQSSGTLSTAYPPDSVMDCEQGTVR
KAGVLAVKNFLVHKKSKKVELATRRKWKNYWVSLKGGTLFLYESDGRSGFDNNSVPKHAL
WVENSIVQAVPEHPKKDFVFCLSNSVGDAFLFQTSGQTELENWITAIHSACAAALARQHH
REDTVRLLRTEIRKLEQKIDMDEKMKKMGDMQLSTVTDAKKRKTIVEQISLWEQNLERFH
IDLFRCRCYLASLQGSEPPNPKRLLGFASRPTKAAMGRLGIFSVSSFHALVSARTESSMR
RRNQSLNRTFNKRRSRFSSLWGLDTASRRKTKGRPSVDQVFCVERELSRKPLERMFEDSA
SEISRKTEDSTKSLPQHNTDNDIWVPDYLRPSWVCLPNNQPVLAIVQPGETTLDVLSSVC
KNHTIDPSGHYLRIKVWVDNQMLFYIPKFEEDISDLLYKEIEICPKPSKVIRFDKAESCT
AGYGFSVAVIDEESVQQLHITEIKEGGLASSKGLKSGDEILSLNGKTASALQMDDMRAAF
ANHTLTLNVSTLPDLDPEVLCFHPPRRSDRDHDLSTDIFSQSQGHPGWCVRSYSGQPRDW
SGLESRVPDLALSNPTFHCKLNTEQGTTFCPSLHDMNSLECPISSSSSSSSSSLSPSPVS
ILPPTAGTATQRQLSHADKLRKVINELVETEKTYVKDLRFLIDRYRKPLQKEHFLTQDEL
DILFGNLGEMVEFQEEFLRTLEDGIRLVPDLDRLERVEQFKKVLFSLGGSFLYYADRFKI
YSAFCASHTKVPKVLAKAKTDPDFKAFLAERNPKQQHSSTLESYLIKPIQRVLKYPLLLR
ELYSHTDPDSEEHYHLDVAMKAMNKVASHINEMQKLHEEYGAVFDQLINEQSVEKKEVPD
LSMGDLLLHSTVVWMNPPVNLMKSKKDTELAAFVFKTAVVFVYKNCSKHRKKIGGTHRTS
AGDNKVPFRFRYMIATDSLQVRGHAMWDSEATAVCEIVHMKSESEGRPERTFQLCCSSPD
SKKDFLKAVHSILREKQRRQFLKSESMPSNQQYAPFGGKRLYFLKGARHSVNRTASAPSR
TLSRKRVLKNKITVDTELIFQDTDNNSDRASPLSANSHPPLGQPQKPHREDTDRWLEEQF
NLGCYEDQCNSIEETVKETDILSDDDEYCKSVRSDSADPEGLKARMEELDLQVDSLSSCG
VSVTSSTLSPVRLAPLKHCVVESPTKKDRDVIWVRRDDFTGVCNSDV
Download sequence
Identical sequences H2LHT4
ENSORLP00000005549 8090.ENSORLP00000005549 ENSORLP00000005549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]