SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2LIP9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2LIP9
Domain Number 1 Region: 354-406
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000157
Family TSP-1 type 1 repeat 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2LIP9
Sequence length 860
Comment (tr|H2LIP9|H2LIP9_ORYLA) Thrombospondin, type I, domain containing 1 {ECO:0000313|Ensembl:ENSORLP00000005880} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN= OC=Oryziinae; Oryzias.
Sequence
LTMDQMFDLMLHVCVFLVAFARLSIWPSFHVALSNGSVFVDFSTKSNSSIVSNLSLSLVD
MGTNATLLTRTLPSNQPVGRVEFNCSCFLYAGTFRFLLRQTSITPAFHANETDGVSVESL
TWWWSSELEVQWPTFHIAVERAANRSDSFQVGISMNEHFQACSSSNKDVLLLEVTYMEYN
QIGRNSIDKIRARVQRPIKALRSQIIDFSCAFPFTEKDFIRVTLRSPHTAQEVKSTEPLY
LSRIFFYKLLVENANAYKSGCVGTMTVKMITPPCAHISGKVLLYSDAPGAGSGAEKSSSP
PLAFNWLTQGENETEFNCSVFHPGKSKYCFRFVFNFSRSPSPAQTCLVVYRSTEQWGPWQ
PWSVCSASCGEAVRERVRECLLPSGVRGLQCSGMIKEQSLCSLEDCVVSPSPSPSPPPVP
VGVSFLGGNMIVVLGISLCLSVIMATVVVTVWRRFCQTPQCSSVRRGSIHSPGGRKLSDE
ASICGHSLQRPSLSDCPGSSGGVAVPADANYRGSQPLSPTLVLPLPQDPERLSPTGQKVL
PSVFGYKLAQQQLKEMKKKGLKEATQLYHVSSSPVHDTVVEKSPNSSSVLSHAELAQSTL
PLSLQDNDDHVCIATPLSKLPAQSSRITPDRLSPKAGLAPGPPVSARSSRGGGGDAESIK
NPTFRRTSSFSDTKFYAASSAQSRHFRERSMTQVSPPHSYIFFSTYFMWDFGLSQKGVLG
AKEDGRDTLTALIPSQKMEFQSGLEAIPIEVTKKSPGIRGPASKPTKSHGTNHLSVDQVE
RAEQNWNRRGPSPIQRNILARKLKEAQSCSGARACKRSSSFNLSSSEQRKGRCRSLPISE
DHSGGSPYRLSEAEQRMLDL
Download sequence
Identical sequences H2LIP9
ENSORLP00000005880 8090.ENSORLP00000005880 ENSORLP00000005880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]