SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2LJI7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H2LJI7
Domain Number - Region: 44-91
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000595
Family HkH motif-containing C2H2 finger 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2LJI7
Sequence length 121
Comment (tr|H2LJI7|H2LJI7_ORYLA) Uncharacterized protein {ECO:0000313|Ensembl:ENSORLP00000006175} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN= OC=Oryziinae; Oryzias.
Sequence
MQYIQEHNSYDDVTAAFLQEVMLSKSLQCSRAIEDSALTALQENDHMTKVEMFHCAACKL
LVPTSGADVKAHITSVDHLRNTKEFEEQQRRACLSKAETLMKELKPQFEHFLNVLKLNGQ
T
Download sequence
Identical sequences H2LJI7
ENSORLP00000006175 ENSORLP00000006175 8090.ENSORLP00000006175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]