SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2LL85 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2LL85
Domain Number 1 Region: 285-333
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000432
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2LL85
Sequence length 339
Comment (tr|H2LL85|H2LL85_ORYLA) Spondin 2a, extracellular matrix protein {ECO:0000313|Ensembl:ENSORLP00000006795} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN=LOC101163419 OC=Oryziinae; Oryzias.
Sequence
MSSERQTCGWWRQLLIVLVKLCLAFAGPLRPLNGTECTAKSPASYILVFTGHWSPQSFPK
QYPLFRPPAQWSKLIAVSHNHHFRLWEEGAAASLGVQKFAELGLTVELMKAGKEARKKRT
VGAMQRTAGIPNGIGHSSTEVHMQPRSSLLSLMVKMIPSPDWFVGVNSLNLCEGNHWKQE
VTVNLQPYDAGTNSGFTFSSPKFPTSPPENISKITSQVPNHPANSFYYPRLKELPAIASI
KITRQHRSANRQTVLSNHILPNSISPRRFSGKVTGNTLFTETPLDCEVSLWSSWGLCLGP
CSRGGIRHRTRYILLRPANAGSPCPELEEQAECVPYSCM
Download sequence
Identical sequences H2LL85
ENSORLP00000006795 8090.ENSORLP00000006795 ENSORLP00000006795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]