SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2LMK7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2LMK7
Domain Number 1 Region: 193-395
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.67e-53
Family DBL homology domain (DH-domain) 0.000000376
Further Details:      
 
Domain Number 2 Region: 2-228
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.31e-38
Family Calponin-homology domain, CH-domain 0.0043
Further Details:      
 
Domain Number 3 Region: 381-542
Classification Level Classification E-value
Superfamily PH domain-like 1.26e-34
Family Pleckstrin-homology domain (PH domain) 0.0047
Further Details:      
 
Domain Number 4 Region: 636-766
Classification Level Classification E-value
Superfamily SH2 domain 1.52e-28
Family SH2 domain 0.0006
Further Details:      
 
Domain Number 5 Region: 786-845
Classification Level Classification E-value
Superfamily SH3-domain 1.25e-21
Family SH3-domain 0.00066
Further Details:      
 
Domain Number 6 Region: 593-665
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000104
Family SH3-domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2LMK7
Sequence length 851
Comment (tr|H2LMK7|H2LMK7_ORYLA) Vav guanine nucleotide exchange factor 3 {ECO:0000313|Ensembl:ENSORLP00000007279} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN=VAV3 OC=Oryziinae; Oryzias.
Sequence
MEYWRQCALWLINCKVLPASHRVTWESAQVFDLAQTLRDGVLLCHLLNNLRPQSINLKVI
NLRPQMSQFLCLKNIRTFLAACNEVFGMKKSDLFDAFDLFDVRNFGKVMDTLSRLSHTAI
AQQTGVRPFPTEDSVDDEDIYNHLEDLMDENGVEDEEDLYDCVYDDEEGGEIYEDLMKTE
AIAPPPFQKQAETDIRSCCLTEIKQTEEKYTETLESIEKHFMTPLTMFLSLVEIEKVFVN
IPELVRVHKCLLLELQDSVLHRSAQNLYQIFIAFKERLLIYGKYCSHVETAIATLDDICK
NREDVRMKLEECSKRANYGKFTLRDLLVVPMQRVLKYHLLLQELVKHTHDTADKSNLRKA
LDAMKDLAQYVNEVKRDNETLREIDQYQKSIENLNQSLRNYGRPKGDGEVRVTSVDRRAK
QDRHIFLFDAAVIVCKRRGDNYEMKEVIDLHLFKITNNPTSDKENRKWSYGFYLTHNQGQ
SGFEFFFKTKELKKKWLEQFGMAISNIRPENAADNFHEFRMHTFDRITSCNSCHMLLRGI
FNQGYLCSKCGLGAHKECLGRFGSCGKTGRQNFFSGIQEDKDFNKGHDWKHKSTGLPKML
AVTNYSGDPSPASGPALYIQTGDIIELICADLQSRWWQGRILETKEVGFFPSEAVRPCPC
VPKPVDFSSQPWFAGPMERLQAEAELINRVNSTYLVRHRSKEYTEYAISIKYNNDVKHIK
ILTKDGCYYIAENKKFRSILELIEYYKHHSLREGFKSLDTTLQFPYRQAENAAVHRLNRS
GGNMLTPKVIGVAIARYDFSSRDTRELSLQEGDVVKIYTKSGANGWWRGEVNGRVGWFPS
TYVEEDYRGHA
Download sequence
Identical sequences H2LMK7
8090.ENSORLP00000007279 ENSORLP00000007279 ENSORLP00000007279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]