SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2LMR5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2LMR5
Domain Number 1 Region: 196-390
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.51e-44
Family DBL homology domain (DH-domain) 0.0000000744
Further Details:      
 
Domain Number 2 Region: 382-507
Classification Level Classification E-value
Superfamily PH domain-like 1.55e-30
Family Pleckstrin-homology domain (PH domain) 0.0000588
Further Details:      
 
Domain Number 3 Region: 113-184
Classification Level Classification E-value
Superfamily SH3-domain 3.02e-24
Family SH3-domain 0.0000701
Further Details:      
 
Domain Number 4 Region: 5-62
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000267
Family Calponin-homology domain, CH-domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2LMR5
Sequence length 796
Comment (tr|H2LMR5|H2LMR5_ORYLA) Uncharacterized protein {ECO:0000313|Ensembl:ENSORLP00000007338} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN=LOC101156802 OC=Oryziinae; Oryzias.
Sequence
KLQFFPEPRSDSDFQKNIAEFLKGLAAFGVEPFEVSDLLQGFNFSKVLNSLVALNKATEG
LGVSGDDGGGAPHSSASSRIKSFDSLNTQGRSSKLLLPQYRSLDMSEGSGCGQPLVKARF
PFQQTNEDELSFSKGDIIVVRRQEEGGWWEGSLNGKTGWFPSNYVRELKGSDKTADKPKS
GTLKSPPKGFDTSIISKTYYNVVLQNILEAETEYSRELQSLLGSYLRSLQPTDRLSSGDI
SHIQANLEEISTFQQMLVQSLDDQTKLPENQQRIGGFFLSLMPQMKTIYVSYCSNHPSAV
GVLTRHSEELGGFMESKGASSPGILALTTSLSKPFTRLDRYPALLKELERHMEDQHPDRA
DLHAVMAAFKHLAAECQEVRKRKDLELQILTEPIRNWEGEDIKSLGAVLHMSQVTVHSQN
CQEVNERYLVLFPHTLLVLSASLRMSGFIYQGRMPLSGMLISRIEDGENWRNAFEISAGG
QCERMQVACNSQRDLQDWLDLLTKHTHTPAHTHRPPCHTLPSHTVTSSRHSEARAGSSAY
HTLPHLSSCETSHSAPSWGPLEPPSTPKPWSLSCLRPAPPLRPSAALCFKEDMSKSPKNM
KKLLPKRKPERKPSEEDVTVRKSTAALEEDAQILKVIEAYCTSAKTRQTLNSTWQGTDLM
HNHVLADGGLAPASLPGNQPCSDQSEDSDYDSIWTAHSHRTASFSRCSRKDVQMLFPEEE
KIIVEETRSNGQTVVEERSLVDTVYSLKDEVQELKQDNKRMKRTLEEEQRARKELERIVR
RVLKNMNDPTWDETNL
Download sequence
Identical sequences H2LMR5
ENSORLP00000007338 ENSORLP00000007338 8090.ENSORLP00000007338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]