SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2LNH0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2LNH0
Domain Number 1 Region: 242-519
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.39e-78
Family Eukaryotic proteases 0.00015
Further Details:      
 
Domain Number 2 Region: 53-150
Classification Level Classification E-value
Superfamily Kringle-like 4.35e-17
Family Kringle modules 0.0016
Further Details:      
 
Domain Number 3 Region: 193-246
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000000167
Family Kringle modules 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2LNH0
Sequence length 522
Comment (tr|H2LNH0|H2LNH0_ORYLA) HGF activator {ECO:0000313|Ensembl:ENSORLP00000007597} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN=HGFAC OC=Oryziinae; Oryzias.
Sequence
GESWGRIHLRNVEQCTCVEGEIQCQRVPYTTCHSNPCQNDGTCRLITSTGKEVCSCRSSY
AGPHCDLQPNTECYKSRGTAYRGVVDTTVSGARCLPWNSDLLYDELHVGTVVAPNLRGLG
EHGFCRCVRSKGGNWSYVNKETQVIIDLCSNCTILTSVDSLGETLDGHMHASTDAGNTLY
YYELRMYHKRSRFHSWKMHKLYIATAVCRNPDGDQKPWCYTVNDSAISWEYCDVPTCVKP
SLKVTVSTTVKKPTSTTKTKSPTCGMKHKKRLTLPRGRILGGSSALPGSHPWMAAIYIGK
SDFCGGSLISSCWIVSAAHCFLSNPLKSQLRVVLGQHFFNNTKFLSNHSRIFEVEDLILP
KHFSVFNPTLHDIVLIKLKKQDGRCVRKSPFIRPICLPEKNMQFPDGYCCTISGWGYTQE
KARDYSPLQEANVRLIPHETCKKPEVYGNHVTSDMICAGLDCVDACQGDSGGPLACAKGD
VSFLYGIISWGEGCGRVGKPGVYTKVVNYIDWIQSVIKRKAK
Download sequence
Identical sequences H2LNH0
ENSORLP00000007597 8090.ENSORLP00000007597 ENSORLP00000007597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]