SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2LNJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2LNJ0
Domain Number 1 Region: 145-404
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.09e-81
Family Eukaryotic proteases 0.00000176
Further Details:      
 
Domain Number 2 Region: 52-155
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000144
Family Hepsin, N-terminal domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2LNJ0
Sequence length 415
Comment (tr|H2LNJ0|H2LNJ0_ORYLA) Uncharacterized protein {ECO:0000313|Ensembl:ENSORLP00000007617} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN=hpn OC=Oryziinae; Oryzias.
Sequence
LSVGSRGISLTCVLTPWRLIGVCVTVMILGAIGAAVWAVVTYCTTEEETGLYDVQVNSSD
QRLRVFDSAQRRWRQVCSSSANELLASISCEEVGFVSVVNYSVAAVPEGSGDVGDFFCVR
QEELSFGKKIKDSLYPCDCESREVLTLLCQDCGRRSFAADRIVGGVDARQGSWPWQVSLQ
YDGVHQCGGSIISNHWIISAAHCFPERYRFVNRWRVLLGSIYNKPVNANVAEVKTIVYHS
SYLPFVDANIDDNSRDIAVLALAQPLTFSENIQPVCLPTYGQRLIDGQVGTVTGWGNVGY
YGALADVLQEANVPIISDVVCNGPDYYDNQITTSMFCAGYEKGGIDACQGDSGGPFVATD
CLSKTSRYRLLGVVSWGTGCAMAKKPGVYTRVSRFLPWISTAMRTHTFQFSLTQI
Download sequence
Identical sequences H2LNJ0
ENSORLP00000007617 8090.ENSORLP00000007617 ENSORLP00000007617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]