SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2LNJ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2LNJ3
Domain Number 1 Region: 467-638
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.56e-41
Family SPRY domain 0.0008
Further Details:      
 
Domain Number 2 Region: 9-82
Classification Level Classification E-value
Superfamily RING/U-box 1.09e-16
Family RING finger domain, C3HC4 0.0093
Further Details:      
 
Domain Number 3 Region: 151-211
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000641
Family B-box zinc-binding domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2LNJ3
Sequence length 641
Comment (tr|H2LNJ3|H2LNJ3_ORYLA) Uncharacterized protein {ECO:0000313|Ensembl:ENSORLP00000007620} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN= OC=Oryziinae; Oryzias.
Sequence
MAHGIQIDRERFSCPLCLFLFNEPVSLPCGHCYCMQCANKHLDHEEDSGIYSCPECRQEF
VSRPLLVRNNILAFVVEELRKTEGSNEDCVDITDGPRQHPHSARPGDVACDVCCEVKLKA
VKSCLQCIASYCEDHLQPHFDVPPLRKHKLVAATAELENSICSKHYEVMKIFCRTDQSCI
CYLCSKEEHKGHEKVSAAAERNEKQNDLQGSRKRIYSKIKRREKDMMTFQQVEDSINVSV
ENALAHTENVFTDLCKMIEKNLSVIKEKAISRQKAEVSRFKKLRESVHQEIAELREKDRK
LENLSRTDDDISFLLNYSSLAQCEDQPSIRIRHLRQFEKVPAVVLEAKDKILDVLDRECA
KIIMTMSGSTASSEPQPQAYKETRDVPDSREGVKTPDPVLENRKDDPVSTFDMSNSSDDH
MSPGFKQREINTSRSAILSGLPPRQASVTPDVVETKSVRDRPSQAEYARPIAMDPSTANP
HLLLSKENRKVVFSSEELCYSASPQRFAFSWQVLSQESLTGRCYLEVERSGRGVLVAVSY
KDISRDGTFRQCMFGDNEKSWALDCFKNSYEFRHNEIRTSIPGTWSSRVGVYVDHDAGLL
LFFSISDTMILLHKVQTTFTQPLYAGLWLSDGAAAEVCKLV
Download sequence
Identical sequences H2LNJ3
ENSORLP00000007620 8090.ENSORLP00000007620 ENSORLP00000007620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]