SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2LPI4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2LPI4
Domain Number 1 Region: 497-689
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.14e-58
Family Hemopexin-like domain 0.00000108
Further Details:      
 
Domain Number 2 Region: 91-216,389-444
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.77e-36
Family Matrix metalloproteases, catalytic domain 0.0000104
Further Details:      
 
Domain Number 3 Region: 276-332
Classification Level Classification E-value
Superfamily Kringle-like 2.74e-22
Family Fibronectin type II module 0.0003
Further Details:      
 
Domain Number 4 Region: 219-274
Classification Level Classification E-value
Superfamily Kringle-like 1.63e-21
Family Fibronectin type II module 0.00037
Further Details:      
 
Domain Number 5 Region: 333-390
Classification Level Classification E-value
Superfamily Kringle-like 4.57e-21
Family Fibronectin type II module 0.00026
Further Details:      
 
Domain Number 6 Region: 27-105
Classification Level Classification E-value
Superfamily PGBD-like 1.26e-19
Family MMP N-terminal domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2LPI4
Sequence length 694
Comment (tr|H2LPI4|H2LPI4_ORYLA) Uncharacterized protein {ECO:0000313|Ensembl:ENSORLP00000007967} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN=mmp9 OC=Oryziinae; Oryzias.
Sequence
LLSYEPLVLMLEILFCVFLPKLFKSVFVTFPGDVIKNMSDTDLAESYLKKFGYMDTFQRS
GFQSLASTSKALKRMQRQLGLDETGQLDMQTLEAMKQPRCGVPDVANYKTFDGDLKWDHG
DVTYRILNYSPDLDSSVTDDAFARAFKVWSDVTPLTFTRLFDGTADIMISFGKKDHGDLY
PFDGKDGLLAHAYPPGEGIQGDAHFDDDEFWTLGKGPVVKTYYGNADGAMCHFPFVFGGK
TYTSCTSEGRADKLPWCSTTDDYDRDGKYGFCPSELLYTIGGNSDGAKCVFPFVFLGDEY
DSCTTEGRRDGYRWCATTSNYDQDKKYGFCPNTDTTTIGGNAEGEPCHFPFEFLGKEYDS
CTSEGRGDGKLWCGTTASYDDDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSNIRDALMY
PMYSYVEDFSLHEDDIEGIQYLYGESIKTDPKPTVPQPNTPTTTATPDPDVTDSTDEPEP
TNRPATTTLNPLDPTKDACKVTKFDTITVIGGDLYFFKDGHFWRKSRKGDAALESPMLIS
ERWPALPAVIDSAFEDILTKKLYFFSVTTGTKFWVYTGKNVLGPRSIEKLGLPDSVQKVE
GALQKGKDKVLLFSGENFWRLDVKTQKIDKGYPKYIDVVFGGVPIDAHDVFLYEGRTFFC
RDQFYWRMNSRRQVDRVGYVKYDLLKCTNPSSRY
Download sequence
Identical sequences H2LPI4
ENSORLP00000007967 ENSORLP00000007967 8090.ENSORLP00000007967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]