SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2LPL9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2LPL9
Domain Number 1 Region: 411-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.1e-17
Family Classic zinc finger, C2H2 0.0022
Further Details:      
 
Domain Number 2 Region: 383-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000455
Family Classic zinc finger, C2H2 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2LPL9
Sequence length 476
Comment (tr|H2LPL9|H2LPL9_ORYLA) Uncharacterized protein {ECO:0000313|Ensembl:ENSORLP00000008003} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN=LOC101169519 OC=Oryziinae; Oryzias.
Sequence
MLNNMDLNSKDSFHPQFENCSSSSLMENTARKDNQEVYVDGERGVPAQFGHEGAPAALKT
EASNSEFAFNPCECPKDTYTPSSLAYSGSFYVEASQGAPCSTETLLNMITEIVGISTLPL
SEVHQSGNSRGTYPSPAPLESGDDSFGDSGVKRQPYTCSGPNPPVYSPDQNCRRYTDDQP
SSQVPDPSTSLLSFGSPRAPNPKKTEPKSEAATFPVVVKNEFESSCYEWGAFSKSECLES
TFQGETFPMSSDFPPDQQVDVKDLLDTFHPICANPEMEFKVEGGIKQEPCFSDTCSQSYS
SPLYNNYLPPPPVGLSNMKPFPEPPQPSNQCDSLYISPAIPSTIDSLLYSSLMPDSFAQS
YNNRPTKPPRARKSPAASHGPAKEKPFTCPMESCDRRFSRSDELNRHIRIHTGHKPFQCR
ICLRSFSRSDHLTTHTRTHTGEKPFSCDVCGKRFARSDERKRHGRVHLKQKEKMEI
Download sequence
Identical sequences H2LPL9
8090.ENSORLP00000008003 ENSORLP00000008003 ENSORLP00000008003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]