SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2LQ51 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2LQ51
Domain Number 1 Region: 5-312
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 5.87e-79
Family Lesion bypass DNA polymerase (Y-family), catalytic domain 0.0000133
Further Details:      
 
Domain Number 2 Region: 318-435
Classification Level Classification E-value
Superfamily Lesion bypass DNA polymerase (Y-family), little finger domain 7.85e-23
Family Lesion bypass DNA polymerase (Y-family), little finger domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2LQ51
Sequence length 699
Comment (tr|H2LQ51|H2LQ51_ORYLA) Polymerase (DNA directed), eta {ECO:0000313|Ensembl:ENSORLP00000008189} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN=polh OC=Oryziinae; Oryzias.
Sequence
MEYGKERVVALVDMDCFYVQVEQRLNPALRNTPCVVAQYKTWKGGGIIAVSYEARAHGVT
RNMWVDDAKKLCPDLQVARVRESHGKADLTHYRDASVEVIEVMSRFAVIERASIDEAYMD
LTAAVQQRLKTTTEEQMSPCLLKTTYIQGYPQNASPEEMILYKEELRSKGLQQWMESLPT
PSSGELNCAELQLTMGALIVEEMRAAVEKQTGFRCSAGISHNKVLAKLACGLNKPNRQTV
LPLESVTELFNSLPIGKIRNLGGKMGASIIETLKVENMGDLTRFSQSQLVQHFGEKTGQW
LYDLCRGVESEAVKPRQLPKSIGCSKNFPGKTSLATKEQVQYWLHQLALELEERLNKDKE
TNGRVAKLLTVGVRQLGDKRPSSFSRCCALVHYEAAKLSSDSFAIIKSLNTAGNHQAAWT
PPLTLLHLSASKFSDAPSSGGIAGFLSAGVAPGRSVSATSKVSTPQASELKQDSACKQRG
SIQAFFQKAPVKQKGVRMDVEEEIPPLSGTSPTCTDDSQLQTAACSSESLPQSKLSSGFC
SFFHKKTLEKSKHEPQNNPGSSENNESKAAETAGAEPQSKRSSELTPHHQPHAEDSDPES
NCNRTSVAAEDLLKCDRCGQEVLVWEMPEHNDYHFALDLQNSISSSTGSSSSSGSPAPLR
GSVQHPQGKTKTRGQFGPAAKRPRSQGGSKGTLDSFFTK
Download sequence
Identical sequences H2LQ51
ENSORLP00000008189 ENSORLP00000008189 8090.ENSORLP00000008189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]