SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2LQV9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2LQV9
Domain Number 1 Region: 191-427
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.7e-80
Family Eukaryotic proteases 0.00000714
Further Details:      
 
Domain Number 2 Region: 39-100
Classification Level Classification E-value
Superfamily GLA-domain 2.16e-19
Family GLA-domain 0.00046
Further Details:      
 
Domain Number 3 Region: 84-170
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000345
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2LQV9
Sequence length 439
Comment (tr|H2LQV9|H2LQV9_ORYLA) Protein C (inactivator of coagulation factors Va and VIIIa), a {ECO:0000313|Ensembl:ENSORLP00000008454} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN=proc OC=Oryziinae; Oryzias.
Sequence
MSRLVLCLIVCVTLWSASVVSLSVFSDAPQAHMLLRSRRANSFLEEMKPPSKERECIEEK
CDFEEAREIFLTREATLEFWTVYTDGNQCQSNLCVHGECVDLFQDYACRCNPGYEGKYCE
YNVTATNCSVNNGDCDHDCIEGEDGQWRKCSCLNGYNLDKNNRKCLPQGTTSCGQLLISR
SEYSEPLVGLLPWMLGGEVGKKGESPWQVVVLNARGNFHCGGVLINRNWVLTAAHCLENN
LQFAVRLGDYELLRKEGTEVMLKVAKAFKHPNYNRETVDNDIALLRLVTPAPFNSYIAPI
CLPGRAMAERVLHLNGTTTVVTGWGKDDSGKYSSALNVIKVPLVSHSVCAQQMLPYTISE
NVLCAGILGQRIDACEGDSGGPMVTLYHGTWFLVGLVSWGEGCGQIDRLGIYTKVSNYND
WIKQVQEEKEAVVLRSVLP
Download sequence
Identical sequences H2LQV9
8090.ENSORLP00000008454 ENSORLP00000008454 ENSORLP00000008454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]