SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2LR32 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2LR32
Domain Number 1 Region: 22-110
Classification Level Classification E-value
Superfamily Kringle-like 5.32e-26
Family Kringle modules 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2LR32
Sequence length 273
Comment (tr|H2LR32|H2LR32_ORYLA) Phosphoinositide-3-kinase interacting protein 1 {ECO:0000313|Ensembl:ENSORLP00000008529} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN= OC=Oryziinae; Oryzias.
Sequence
QVAAWSRTLVSAGVVGSSASAQTDCVRSDGLDYRGKQQSSSSGLACLNWINITRDYDAEI
HPDSQTGAGDHNYCRNPDASERPWCYIAGPDGTIQRQFCTIETCKVKMYLTAESAEQTSA
APVETASSAPTGSTASEESFQPARSRISQAEVAAVQPVMGISQRVHTGPRKKKDLGTTGY
VLAILMMAIIIILGVGITLGYFYKRGRDLKKQHDQRVYEREMQRITLPLSAFYNPTCELI
DENTIVITAEPETTPVQEGEDPLMGQHAGTPGA
Download sequence
Identical sequences H2LR32
ENSORLP00000008529 ENSORLP00000008529 8090.ENSORLP00000008529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]